Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Reg3b

Uniprot No.

P35230

Research Area

Others

Alternative Names

REG-3-beta;Pancreatitis-associated protein 1;Regenerating islet-derived protein III-beta;Reg III-beta

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

38-175aa

Target Protein Sequence

ISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

28.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Bactericidal C-type lectin which acts against several intestinal Gram-positive and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.

Gene References into Functions

Reg3beta is a prognostic biomarker for acute coronary syndrome and is strongly associated with the intensity of cardiac inflammation. PMID: 29544958
The pancreas reacts to remote lesions and septic insults in mice and rats with increased PSP synthesis, while PAP is selectively responsive to septic events. Furthermore, our results suggest that serum PSP in septic patients is predominantly derived through an acute phase response of the pancreas. PMID: 28415799
BMI1 and MEL18 contribute to the development of colitis-associated cancer in mice by promoting proliferation and reducing apoptosis via suppressing expression of Reg3b. REG3B negatively regulates cytokine-induced activation of STAT3 in colon epithelial cells. PMID: 28780076
Intestinal deficiency in REG3B or REG3G increases numbers of mucosa-associated bacteria and enhances bacterial translocation to the mesenteric lymph nodes and liver. PMID: 26867181
our findings reveal a dual and contextual pathophysiologic role for REG3beta during pancreatitis and pancreatic ductal adenocarcinoma initiation PMID: 26404002
our findings unveil a new metabolic role for Reg3beta in protein nitration and a new biosynthesis control of GPX1 by a completely "unrelated" regenerating protein, Reg3beta, via transcriptional activation of Scly PMID: 23811004
Reg3beta-dependent accumulation of macrophages in the ischemic heart has a role in myocardial healing PMID: 25751817
High Reg3B expression is associated with pancreatic tumor growth. PMID: 23867474
Direct stimulation of Reg2 and Reg3beta genes by glucocorticoids. PMID: 23147030
Pancreatic STAT3 is indispensable for PAP1 production. PMID: 23064197
Expression of Reg3 proteins and Ang4 by goblet cells point to an important role for goblet cells in innate defense. PMID: 22723890
Reg-IIIbeta is expressed in specific subsets of primary sensory neurons and motor neurons; expression is transient during the embryonic and perinatal periods. PMID: 21681751
Reg3b plays a protective role against intestinal translocation of the gram-negative bacterium Salmonella enteritidis in mice but not against the gram-positive bacterium Listeria monocytogenes. PMID: 22252863
RegIIIbeta production by the host can promote S. Typhimurium infection by eliminating inhibitory gut microbiota. PMID: 21694778
Reg2, Reg3alpha, and Reg3beta were abundantly expressed in most acinar cells of the pancreas with clear age-dependent and isoform-specific patterns. PMID: 21410322
These data are consistent with a pleiotropic role for INGAP and reveal new pathways to target in the discovery of improved diabetic therapies PMID: 21187123
Reg3beta is unlikely an islet growth factor but a putative protector that prevents streptozotocin-induced damage by inducing the expression of specific genes. PMID: 21245462
the expression of the anti-inflammatory protein pancreatitis-associated protein I is enhanced by p8 PMID: 14660681
Deletion of the mouse RegIIIbeta (Reg2) gene disrupts ciliary neurotrophic factor signaling and delays myelination of mouse cranial motor neurons PMID: 18678917

Hide All

Involvement in disease

Overexpressed during the acute phase of pancreatitis.

Subcellular Location

Secreted.

Tissue Specificity

Constitutively expressed in the small intestine, moderately in colon and at an extremely low level in healthy pancreas.

Database Links

KEGG: mmu:18489

STRING: 10090.ENSMUSP00000094667

UniGene: Mm.2553

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP333982MO
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage