Recombinant Mouse Renin-2 (Ren2), partial

In Stock
Code CSB-EP360582MO1
Abbreviation Recombinant Mouse Ren2 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ren2
Uniprot No.
Research Area
Neuroscience
Alternative Names
Ren2; Ren-2; Renin-2; EC 3.4.23.15; Angiotensinogenase; Submandibular gland renin) [Cleaved into: Renin-2 heavy chain; Renin-2 light chain]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
64-351aa
Target Protein Sequence
SSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAQFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEKVFSVYYNRGPHLLGGEVVLGGSDPEHYQGDFHYVSLSKTDSWQITMKGVSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQALGAKEKRLHEYVVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQYPN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Renin is a highly specific endopeptidase, related to pepsin, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. Its function in the salivary gland is not understood.
Gene References into Functions
  1. Suppression of ACE-ANG II axis in the circulation and kidney tissue, combined with augmentation of the intrarenal vasodilator ACE2-ANG 1-7 axis, is the main mechanism responsible for blood pressure-lowering effects of chronic hypoxia in mRen2 rat. PMID: 25194129
  2. Intrapulmonary activation of the angiotensin-converting enzyme type 2/angiotensin 1-7/G-protein-coupled Mas receptor axis attenuates pulmonary hypertension in Ren-2 transgenic rats exposed to chronic hypoxia. PMID: 25194138
  3. BP-lowering effect of sEH inhibition in I3C-induced Cyp1a1-Ren-2 transgenic rats. PMID: 25224811
  4. Hypertension fails to disrupt white matter integrity in young or aged Fisher (F44) Cyp1a1Ren2 transgenic rats. PMID: 25407269
  5. A deficitcin Ang-(1-7) in the brain of hypertensive (mRen2)27 rats maycbe a contributing factor to higher blood pressure and alteredcautonomic balance in this strain. PMID: 22526299
  6. Data show that the GPR30 agonist G-1 mitigates the adverse effects of oestrogen loss on LV remodelling and the development of diastolic dysfunction in oophorectomized mRen2 Lew rats. PMID: 22328091
  7. Epoxide hydrolase inhibitors displays antihypertensive effects in Ren-2 transgenic rats with inducible malignant hypertension via an improvement of renal function. PMID: 21078594
  8. Despite similar reductions in blood pressure and renal ET-1 and ANG II levels aliskiren appears to be more effective than losartan, at the doses used, in reducing albuminuria in heterozygous hypertensive Ren-2 rats. PMID: 20666571
  9. The increase in urinary angiotensinogen with estrogen depletion or high salt may be a biomarker for glomerular damage reflecting filtration of the circulating protein in the mRen2 Lewis rat strain. PMID: 20462965
  10. Compared treatment with a renin inhibitor vs. an AT1R blocker on renal oxidative stress and associated glomerular structural and functional changes in the transgenic Ren2 rat, which manifests hypertension, albuminuria, and increased tissue RAS activity. PMID: 20007350
  11. Androgens contribute not only to the development of hypertension, but even more importantly to end-organ damage in TGR(mREN2)27 rats. PMID: 12397037
  12. NO synthesis and/or bioavailability as well as sensitivity of arterial smooth muscle cells to NO are decreased in mREN2 rats. PMID: 12512695
  13. The greater blood pressure response to L-NAME in ren-2 transgenic rats suggests that prehypertensive rats exhibit an enhanced NO activity in the systemic vasculature PMID: 15795515
  14. Ren-2 and angiotensin II have roles in nephrosclerosis PMID: 16522658
  15. increased arterial pressure, reduction of renal haemodynamics, and enhancement of intrarenal Ang II levels in hypertensive Cyp1a1-Ren2 transgenic rats PMID: 17083061
  16. Blockade of the renin-angiotensin system but not antihypertensive therapy with atenolol reduces vascular pathology in diabetic Ren-2 retina, suggesting that angiotensin II is a causative factor and therapeutic target in diabetic retinopathy. PMID: 17386351
  17. Ovariectomy in the older female mRen2.Lewis rat conveys protection against salt-dependent increase in renal injury. PMID: 17630347
  18. Oxidative stress contributes to pulmonary hypertension in the transgenic (mRen2)27 rat. PMID: 18424632
  19. Report sex differences in circulating and renal angiotensins of hypertensive mRen(2).Lewis but not normotensive Lewis rats. PMID: 18456730
  20. suggests that Ang II causes development and progression of NAFLD in the transgenic Ren2 rat model by increasing hepatic ROS PMID: 18486983
  21. Perindopril attenuates tubular hypoxia and inflammation in an experimental model of diabetic nephropathy in transgenic Ren-2 rats. PMID: 18826488
  22. Chronic immunoneutralization of brain angiotensin-(1-12) lowers blood pressure in transgenic (mRen2)27 hypertensive rats. PMID: 19403863
  23. Dual ACE-inhibition and AT1 receptor antagonism improves ventricular lusitropy without affecting cardiac fibrosis in the congenic mRen2.Lewis rat. PMID: 19531557
  24. Found that prorenin and aldosterone alone are not sufficient to induce considerable cardiac fibrosis in the absence of sodium load. PMID: 19749160

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase A1 family
Tissue Specificity
Submandibular gland.
Database Links

KEGG: mmu:19702

UniGene: Mm.220955

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*