Recombinant Mouse Rho-related GTP-binding protein RhoB (Rhob)

Code CSB-EP019683MO
Abbreviation Recombinant Mouse Rhob protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Rhob;Arhb
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-193aa
Target Protein Sequence
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
Gene References into Functions
  1. These results highlight a newly identified function for RhoB in supporting the specific production of pathogenic autoantibodies. PMID: 28882929
  2. the histone deacetylase inhibitor trichostatin A increased miR-223 expression obviously in TLR-triggered macrophages, which in turn suppressed RhoB expression and downstream IL-6 production, suggesting that the inhibition of miR-223 by histone deacetylation may be involved in the regulation of TLR-activated inflammatory response. PMID: 28881218
  3. these results suggest that RhoB plays an important role in the hypoxia-induced activation of macrophages and the inflammatory response. PMID: 26388235
  4. RhoB-deficient cells accumulate endogenous gammaH2AX and chromosomal abnormalities, suggesting that RhoB loss increases double-strand break-mediated genomic instability and tumor progression. PMID: 24912678
  5. Loss of RhoB decreases pathological angiogenesis in the ischemic retina and reduces angiogenesis in response to cutaneous wounding, but enhances lymphangiogenesis following both dermal wounding and inflammatory challenge PMID: 24280686
  6. UVB-induced RhoB expression participates in in vivo squamous cell carcinoma initiation by increasing keratinocyte survival. PMID: 23792460
  7. the cytoprotective RhoB response is not only evoked by bacterial protein toxins inactivating Rho/Ras proteins but also by the Rac1-activating toxin CNF1. PMID: 23732113
  8. In cancer cells in vitro or in vivo, RhoB functions as a tumor suppressor that restricts EGF receptor (EGFR) cell surface occupancy as well as Akt signaling PMID: 23135917
  9. RhoB mediates adaptational changes to acute hypoxia in the vasculature, but its continual activation by chronic hypoxia can accentuate vascular remodeling to promote development of pulmonary hypertension. PMID: 22539766
  10. These data directly implicate neuronal RhoB in caspase 3 activation and the initial stages of programmed cell death. PMID: 22098422
  11. miR-21 as a new angiogenesis inhibitor through repression of RhoB PMID: 21347332
  12. findings strongly support a physiological role of RhoB in regulation of thymus development and maintenance through the inhibition of TGF-beta signaling in thymic medullary epithelium PMID: 21865151
  13. RhoB links PDGF signaling to cell migration by coordinating activation and localization of Cdc42 and Rac. PMID: 21344485
  14. RhoB is a modifier of diabetes, important for the induction of beta-cell loss. PMID: 21224061
  15. These data implicate RhoB in cofilin regulation and dendritic and spine morphology, highlighting its importance in synaptic plasticity at a structural and functional level. PMID: 20203211
  16. RhoB-regulated mDia1 has a role in the regulation of hematopoietic progenitor cells PMID: 19768111
  17. Results suggest that constitutive activation of the Rho-ROCK-LIM kinase pathway by extracellular production of lysophosphatidic acid by the action of autotaxin is required to maintain the large size of lysosomes in visceral endoderm cells. PMID: 19808661
  18. RhoB is dispensable for normal cell physiology but it has a suppressor or negative modifier function in stress-associated processes including cancer. PMID: 11905808
  19. RhoB isoprenylation is necessary for its rapid turnover; there is a link between the cholesterol biosynthetic pathway and the regulation of G-protein expression PMID: 12384510
  20. The geranylgeranyltransferase-I inhibitor GGTI-298 inhibits the RhoB pathway and disrupts stress fiber and focal adhesion formation in NIH-3T3 cells. PMID: 12548020
  21. RhoB expression is suppressed by EGFR, ErbB2 and Ras, but not Src. PMID: 14647415
  22. RhoB has a role as a tumor suppressor in lung neoplasms PMID: 15102679
  23. suppression of RhoB as a mechanism by which the Ras/PI3K/Akt pathway induces tumor survival, transformation, invasion, and metastasis PMID: 15169915
  24. Ultraviolet light induces stress-activated signal transduction leading to nuclear/cytoplasmic shuttling of HuR proteinand subsequent stabilization of RhoB mRNA. PMID: 15543229
  25. RhoB mediated transcriptional suppression but also accumulation of Cyclin B1 in the cytosol at early times after farnesyl transferase inhibitor treatment, at a time before the subsequent reduction in steady-state protein levels PMID: 15548709
  26. RhoB and actin polymerization coordinate Src activation with endosome-mediated delivery to the membrane PMID: 15572128
  27. RhoB-F and RhoB-GG which differ only by a 5-carbon isoprene behave differently in rodent cells highlighting the important role of prenyl groups in protein function and emphasize the potency of RhoB to regulate negatively the oncogenic signal. PMID: 15748883
  28. Farnesylated Rhob inhibits radiation-induced mitotic cell death and controls radiation-induced centrosome overduplication. PMID: 15776002
  29. The ability of RhoB to support GSK-3-dependent turnover of c-Myc offers a mechanism by which RhoB acts to limit the proliferation of neoplastically transformed cells PMID: 16247449
  30. These data suggest that, although RhoB is expressed by Muller cells in chick and mouse, its role in the maintenance of cellular morphology and regulation may be different. PMID: 16385489
  31. RhoB was upregulated by Rho-/Ras-inactivating toxins, as a consequence of the inactivation of either Rho(A,B,C) or (H-,K-,N-)Ras. In TcdB-treated cells, RhoB escaped its inactivation and was required for the cytotoxic effect. PMID: 17397186
  32. RhoB affects cell shape and migration by regulating surface integrin levels. PMID: 17692842
  33. mouse RhoB transcription is epigenetically regulated in a tissue-specific manner during aging by histone modification, but not by CpG methylation PMID: 17706596
  34. Suggest RhoB is a critical regulator of PDGFR-beta trafficking and signaling in vascular smooth muscle cells. PMID: 17951322
  35. Vibrio parahaemolyticus induces a rapid remodeling of macrophage actin and activates RhoB GTPase via translocation of VP1686. PMID: 18239436
  36. In vivo restoration of RhoB expression leads to ovarian tumor regression. PMID: 18340357
  37. Rhob plays an important role in the antiproliferative effect of glucocorticoid receptor (GR) on RAW264.7 cells. PMID: 18840672
  38. Rhob expression is associated with hematopoietic stem cells that have durable self-renewal potential PMID: 19377048
  39. RhoB is essential for apoptosis and antineoplastic activity of farnesyltransferase inhibitors in a mouse model. PMID: 10913192
  40. Loss of RhoB did not adversely affect mouse development, fertility, or wound healing. However, embryo fibroblasts cultured in vitro exhibited a defect in motility, suggesting that RhoB has a role in this process that is conditional on cell stress PMID: 11564874

Show More

Hide All

Subcellular Location
Late endosome membrane; Lipid-anchor. Cell membrane; Lipid-anchor. Nucleus. Cleavage furrow.
Protein Families
Small GTPase superfamily, Rho family
Database Links

KEGG: mmu:11852

STRING: 10090.ENSMUSP00000067013

UniGene: Mm.687

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*