Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Sfrp5; Secreted frizzled-related protein 5; sFRP-5
Species
Mus musculus (Mouse)
Expression Region
22-314aa
Target Protein Sequence
APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Mouse Sfrp5 contains amino acids 22-314. The theoretical molecular weight of the Sfrp5 protein is 37.2 kDa. This protein is generated in a e.coli-based system. The Sfrp5 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant Sfrp5 protein in following stages of expression and purification.
The mouse-derived secreted frizzled-related protein 5 (Sfrp5) is a member of the SFRP family, known for modulating Wnt signaling. Sfrp5 acts as a soluble antagonist to Wnt ligands, preventing their interaction with Frizzled receptors. This interference regulates various cellular processes, including embryonic development, tissue homeostasis, and cell differentiation. In research, Sfrp5 has been implicated in adipose tissue biology and metabolic regulation. It plays a role in the regulation of adipogenesis and inflammation in adipose tissues, contributing to metabolic homeostasis. Additionally, studies explore the potential of Sfrp5 as a therapeutic target for obesity-related metabolic disorders and its involvement in insulin sensitivity.
