Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Sfrp5

Uniprot No.

Q9WU66

Research Area

Stem Cells

Alternative Names

Sfrp5; Secreted frizzled-related protein 5; sFRP-5

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

22-314aa

Target Protein Sequence

APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

37.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Mouse Sfrp5 contains amino acids 22-314. The theoretical molecular weight of the Sfrp5 protein is 37.2 kDa. This protein is generated in a e.coli-based system. The Sfrp5 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant Sfrp5 protein in following stages of expression and purification.

The mouse-derived secreted frizzled-related protein 5 (Sfrp5) is a member of the SFRP family, known for modulating Wnt signaling. Sfrp5 acts as a soluble antagonist to Wnt ligands, preventing their interaction with Frizzled receptors. This interference regulates various cellular processes, including embryonic development, tissue homeostasis, and cell differentiation. In research, Sfrp5 has been implicated in adipose tissue biology and metabolic regulation. It plays a role in the regulation of adipogenesis and inflammation in adipose tissues, contributing to metabolic homeostasis. Additionally, studies explore the potential of Sfrp5 as a therapeutic target for obesity-related metabolic disorders and its involvement in insulin sensitivity.

Target Background

Function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina.

Gene References into Functions

Sfrp5 identifies murine cardiac progenitors for all myocardial structures except for the right ventricle. PMID: 28287088
SFRP5 be a target gene of PPARgamma. PMID: 29066306
The balance of factors controlling fat deposition can be evaluated in part by the differential expression profiles of Mest and Sfrp5 genes with functions linked to fat deposition as long as there is an active accumulation of fat mass. PMID: 26001362
the expression of Mest and Sfrp5 were tightly associated across the 5 mouse strains with the highest and lowest expression occurring in DBA/2J and C57BL/6J (B6) respectively suggesting a common mechanism for their regulation. PMID: 26005096
although high sFRP5 expression inhibits B-lymphopoiesis in vivo, physiologically, it contributes to the preservation of very primitive lymphopoietic progenitors, including hematopoietic stem cells, under high estrogen levels PMID: 25676235
A role for SFRP5 in glucose metabolism and pancreatic beta-cell function indicates that the use of an anti-SFRP5 mAb as a potential approach to treat type 2 diabetes. PMID: 25370851
Sfrp5 mRNA expression and protein secretion depend on the differentiation of adipocytes. The dysregulation of Sfrp5 expression and secretion is directly correlated with insulin resistance. PMID: 22582808
early progeny of Sox2-positive stem cells transiently expressed the Wnt inhibitor Sfrp5 PMID: 22819339
SFRP5 inhibits WNT signaling to suppress oxidative metabolism and stimulate adipocyte growth during obesity. PMID: 22728933
data show Sfrp5 is an anti-inflammatory adipokine whose expression is perturbed in models of obesity and type 2 diabetes; in obesity, Sfrp5 secretion exerts salutary effects on metabolic dysfunction by controlling adipose tissue inflammatory cells PMID: 20558665
Here we report that the Secreted frizzled-related protein 5 (Sfrp5) gene, which encodes a secreted factor that can antagonize Wnt signaling, is expressed in the AVE and foregut endoderm during early mouse development PMID: 12972006
Sfrp5 is not essential for axis formation or foregut morphogenesis in the mouse. Sfrp5 and Dkk1 together are not essential for anterior visceral endoderm development. PMID: 17133501
Sfrp5 locally inhibits Wnt11 to maintain early foregut identity and to allow an epithelium to form over a mass of tissue undergoing Wnt-mediated cell movements. PMID: 18981481

Hide All

Subcellular Location

Secreted.

Protein Families

Secreted frizzled-related protein (sFRP) family

Database Links

KEGG: mmu:54612

STRING: 10090.ENSMUSP00000018966

UniGene: Mm.470071

Code	CSB-EP021141MO
Abbreviation	Recombinant Mouse Sfrp5 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Secreted frizzled-related protein 5 (Sfrp5)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage