Recombinant Mouse Serglycin (Srgn)

In Stock
Code CSB-EP022664MO
Abbreviation Recombinant Mouse Srgn protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Srgn
Uniprot No.
Research Area
Cell Biology
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
75-152aa
Target Protein Sequence
EGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The creation of the recombinant Mouse Srgn protein is achieved through genetic engineering techniques. A specific DNA sequence coding for the Mouse Srgn protein (75-152aa) is integrated into an expression vector, which serves as a carrier for gene expression. This vector is then introduced into e.coli cells, which are cultured to facilitate the expression of the desired protein. The protein is fused with a C-terminal 6xHis tag. The recombinant Mouse Srgn protein is subsequently purified using affinity purification, resulting in a purity level exceeding 90%, as verified by SDS-PAGE analysis.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : in vivo

Review: We added exogenous recombinant SRGN to observe the infuence of SRGN overload on microglial activation in vitro and in vivo, while we utilized gene knockout mice to eliminate SRGN.As a result, exogenous injection of rSRGN led to an enlarged infarct volume than solvent controls (Fig. 2B, C).

By Anonymous

Target Background

Function
Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization.
Gene References into Functions
  1. serglycin produced in lipopolysaccharide-induced inflammation in normal mouse chondrocytes is able to modulate inflammation by interacting with CD44 receptor, suggesting a possible key role in the cartilage inflammation. PMID: 29588174
  2. Findings indicate that PRG-1 deficiency led to over-excitability caused by an altered LPA/LPA2-R signaling inducing a behavioral phenotype typically observed in animal models for psychiatric disorders. PMID: 28843862
  3. this study shows that the serglycin-deficient mice are more susceptible to Trichinella spiralis infection and display an unbalanced immune response PMID: 27267469
  4. Data suggest that serglycin proteoglycans play a role in extravasation as well as colonization and growth of metastatic cells. PMID: 27223472
  5. serglycin deficient mice exhibited elevated concentrations of serum LDL after feeding high-fat diet for 20 weeks. PMID: 26391682
  6. Dopamine storage increased during mast cell maturation from bone marrow precursors, and was dependent on the presence of serglycin. PMID: 22628305
  7. Cells lacking mouse mast cell protease 6 exhibited similar defects in apoptosis as observed in serglycin(-/-) cells, indicating that the pro-apoptotic function of serglycin is due to downstream effects of proteases that are complex-bound to serglycin PMID: 22493512
  8. The PRG-1 transcription is initiated at multiple transcription start site and no influence on expression in vivo by Nex1 deficiency. PMID: 21805347
  9. serglycin proteoglycan as a novel player in mast cell apoptosis. PMID: 21123167
  10. serglycin proteoglycan is dispensable for normal secretion and activity of mast cell proteases in response to peritoneal infection with T. gondii. PMID: 20864536
  11. SG proteoglycan has a key role in mast cell function PMID: 15231821
  12. serglycin is the major proteoglycan secreted by peritoneal macrophages and the macrophage serglycin may have a role in regulating secretion of tumor necrosis factor-alpha PMID: 16807245
  13. The reduced amounts of proteases in the absence of serglycin is not caused by missorting, but rather that serglycin may be involved in the retention of the proteases after their entry into secretory vesicles PMID: 17010166
  14. Serglycin is of crucial importance for assembly of mature mucosal mast cell granules, but the specific dependence on SG for storage varies between individual granule constituents. PMID: 17147513
  15. Neutrophil elastase depends on serglycin proteoglycan for localization in granules. PMID: 17272511
  16. SG is crucial for platelet function and thrombus formation PMID: 18094327
  17. Histamine and serotonin storage in mast cells is dependent on serglycin proteoglycan. PMID: 18234316
  18. the present report points to a novel, previously unrecognized role for serglycin proteoglycan in regulating the kinetics of antiviral CD8(+) T cell responses PMID: 18606656
  19. These findings are thus in accordance with a role for the N-terminal disulfide motif in serglycin for regulation of mast cell secretory granule integrity. PMID: 19059647
  20. SGC deficiency causes multiple, age-related effects on the lymphoid system PMID: 19088175
  21. mast cell maturation is associated with the expression of a distinct signature of genes involved in serglycin proteoglycan synthesis, and that mast cell activation modulates their expression. PMID: 19915053

Show More

Hide All

Subcellular Location
Cytoplasmic granule. Cytolytic granule. Secreted, extracellular space. Golgi apparatus.
Protein Families
Serglycin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*