Code | CSB-YP835578MOb0 |
Size | US$1593 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The expression vector recombined with the recombinant DNA was transfected into the yeast cells for expression. The recombinant DNA resulted from the fusion of the gene coding for the 21-418aa of the mouse Serpina3n protein and the N-terminal 10xHis tag gene. The product was purified and isolated to get the recombinant mouse Serpina3n protein with N-terminal 10xHis tag. This recombinant Serpina3n protein's purity reaches up to 85%. Under SDS-PAGE condition, this recombinant Serpina3n protein showed a band with a molecular weight of about 45 kDa on the gel. Serpina3n is a serine protease inhibitor and belongs serpin family which is the largest protease inhibitor family. Serpina3n is a recently identified novel serine protease inhibitor, α1-antichymotrypsin–like protein, from EB22, a murine chondrocytic cell line. This protein is expressed at high levels in brain, heart, liver, lung, spleen, testis and thymus, and at low levels in bone marrow, kidney and skeletal muscle. The function of this protein is still unknown. A study has reported that mice lacking SerpinA3N developed more neuropathic mechanical allodynia than wild-type (WT) mice, and exogenous delivery of SerpinA3N attenuated mechanical allodynia in WT mice. Additionally, another study found Serpina3n as the most female osteoblast–dominant gene. This study demonstrated that Serpina3n exerts a suppression of the osteoblast phenotypes such as Col1a1 expression and ALP activity in differentiated osteoblasts, which might partly explain sex differences of the osteoblast phenotypes in mice. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | Serpina3n |
Uniprot No. | Q91WP6 |
Research Area | Others |
Alternative Names |
Serpina3n; Spi2; Serine protease inhibitor A3N; Serpin A3N
|
Species | Mus musculus (Mouse) |
Source | Yeast |
Expression Region | 21-418aa |
Target Protein Sequence | FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 47.3 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 10xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Subcellular Location | Secreted. |
Protein Families | Serpin family |
Tissue Specificity | Expressed at high levels in brain, heart, liver, lung, spleen, testis and thymus, and at low levels in bone marrow, kidney and skeletal muscle. |
Database Links |
STRING: 10090.ENSMUSP00000021506 UniGene: Mm.482074 |