Recombinant Mouse Serine protease inhibitor A3N (Serpina3n)

In Stock
Code CSB-EP835578MO
Abbreviation Recombinant Mouse Serpina3n protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Serpina3n
Uniprot No.
Research Area
Others
Alternative Names
Serpina3n; Spi2; Serine protease inhibitor A3N; Serpin A3N
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
21-418aa
Target Protein Sequence
FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Serine protease inhibitor A3N (Serpina3n) is expressed in E.coli and features a full-length mature protein spanning amino acids 21 to 418. It comes with an N-terminal 6xHis-SUMO tag, which helps with purification and detection. The product shows purity greater than 85% as determined by SDS-PAGE. This is strictly for research use only and is not suitable for therapeutic applications.

Serine protease inhibitor A3N, also known as Serpina3n, belongs to the serpin family. These proteins appear to play crucial roles in regulating protease activity. This particular protein acts as an inhibitor of serine proteases, which are involved in various biological processes such as inflammation and immune response. The way it modulates protease activity may make it a valuable tool for studying protease-related pathways and mechanisms in research settings.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Recombinant Mouse Serine protease inhibitor A3N (Serpina3n) is expressed in E.coli and features a full-length mature protein spanning amino acids 21 to 418. It comes with an N-terminal 6xHis-SUMO tag, which helps with purification and detection. The product shows purity greater than 85% as determined by SDS-PAGE. This is strictly for research use only and is not suitable for therapeutic applications.

Serine protease inhibitor A3N, also known as Serpina3n, belongs to the serpin family. These proteins appear to play crucial roles in regulating protease activity. This particular protein acts as an inhibitor of serine proteases, which are involved in various biological processes such as inflammation and immune response. The way it modulates protease activity may make it a valuable tool for studying protease-related pathways and mechanisms in research settings.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The mouse Serpina3n protein is expressed in E. coli, a prokaryotic system that often fails to properly fold eukaryotic proteins, especially those like Serpina3n that may require specific post-translational modifications, disulfide bond formation, or chaperone-assisted folding for native conformation. While the N-terminal 6xHis-SUMO tag can improve solubility and potentially aid folding, no functional assays (e.g., serine protease inhibition activity) or structural validation (e.g., circular dichroism) are mentioned. Thus, the protein's folding and activity status are uncertain without experimental verification.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-SUMO tag facilitates purification and immobilization for pull-down experiments. However, if the protein is not correctly folded, it may not retain native binding properties, leading to false positives or negatives. Researchers should first validate folding (e.g., via activity assays) before use. The SUMO tag could enhance stability, but results should be interpreted cautiously.

2. Antibody Development and Validation

This recombinant Serpina3n can serve as an immunogen, but if misfolded, generated antibodies may not recognize the native protein in physiological contexts. The high purity (>85%) reduces contamination risks, but antibodies should be validated against correctly folded Serpina3n. Techniques like ELISA or Western blotting must include controls for conformational specificity.

3. Structural and Biophysical Characterization Studies

These applications require a correctly folded protein. If misfolded, structural data (e.g., from crystallography or NMR) would be invalid. Biophysical assays (e.g., circular dichroism) should first confirm folding. The E. coli expression system may produce aggregates or non-native conformations, limiting reliability without validation.

4. In Vitro Biochemical Assays and Enzyme Kinetics

This application depends on bioactivity. Without evidence of correct folding, inhibitory activity against serine proteases may be absent. Researchers should perform preliminary activity tests before kinetics studies. If inactive, the protein is unsuitable for such assays.

5. Cell-Based Functional Studies

Adding recombinant protein to cells assumes bioactivity and proper folding. If misfolded, cellular responses may be non-physiological. The His-SUMO tag aids tracking, but functionality must be verified (e.g., via protease inhibition in cells). Dose-response studies should include folding controls.

Final Recommendation & Action Plan

Given the uncertainty in protein folding and bioactivity, it is essential to prioritize validation before any application. Recommend performing functional assays (e.g., testing serine protease inhibition activity) and structural checks (e.g., circular dichroism or size-exclusion chromatography) to confirm native conformation. If validated, the protein can be used as described; otherwise, applications like enzymatic studies or cellular assays should be avoided or reinterpreted. Always include appropriate controls and consider using alternative expression systems (e.g., mammalian cells) if folding issues persist.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

What's the difference between this protein and CSB-EP835578MO(M)?

A:
Thanks for your interests, they are the same protein, but the CSB-EP835578MO(M) have some mutation , you can see it from their sequence:
1.The 1st aa change from F to SF.
2. The 295th aa S missing. The sequence of CSB-EP835578MO(M):

SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK


The sequence of CSB-EP835578MO:

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Target Background

Subcellular Location
Secreted.
Protein Families
Serpin family
Tissue Specificity
Expressed at high levels in brain, heart, liver, lung, spleen, testis and thymus, and at low levels in bone marrow, kidney and skeletal muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*