Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1)

In Stock
Code CSB-YP362579MO
Abbreviation Recombinant Mouse Spink1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Spink1
Uniprot No.
Research Area
Others
Alternative Names
Spink1; Spink3; Serine protease inhibitor Kazal-type 1; P12; Prostatic secretory glycoprotein; Serine protease inhibitor Kazal-type 3
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
24-80aa
Target Protein Sequence
AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Mouse Spink1 is a recombinant protein product meticulously designed to support your scientific inquiries. This product embodies the full-length mature form of P12, alternatively known as Prostatic Secretory Glycoprotein or Serine Protease Inhibitor Kazal-type 3. It's derived from mouse species and generated through a yeast expression system, furthering its utility in a variety of research contexts.

The protein of interest spans from the 24th to the 80th amino acid region, making it an exact representation of the mature form. It features an N-terminal 6xHis-tag, which enhances its visibility and ease of purification in experimental processes. The product's purity exceeds 90% as confirmed by SDS-PAGE, ensuring its consistency and reliability. Depending on your experimental needs, you can opt for the Recombinant Mouse Spink1 in a liquid or lyophilized powder form.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.
Gene References into Functions
  1. It is a trypsin-specific inhibitor in the pancreas. PMID: 24521862
  2. IFN regulatory factor 2 (Irf2) has a regulatory role in trypsinogen5 gene transcription, which is resistant to a major endogenous trypsin inhibitor, Spink3 PMID: 22042864
  3. SPINK3 modulates sperm physiology through a downstream reduction of endogenous NO concentration and independently of SPINK3 trypsin inhibitory activity. PMID: 22228629
  4. uterine-gland-derived SPINK3, as a new paracrine modulator, might play an important role in embryo implantation through its influence on stromal decidualization in mice. PMID: 20623140
  5. Spink3 may act as a growth factor, leading to cell proliferation and regeneration of tissue structure. PMID: 20660988
  6. Results suggest that regulation of Prss1 and Spink3 expression is involved in the susceptibility to experimentally induced pancreatitis. PMID: 20157294
  7. Spink3 trypsin inhibitor is required for normal pancreatic development. Data indicate an important relationship between endogenous pancreatic trypsin and Spink3 and the development of pancreatitis. PMID: 20110462
  8. SPINK3 mRNA is upregulated in chronic pancreatitis. PMID: 15097871
  9. Spink3 may play important roles in proliferation and/or differentiation of various cell types during development. PMID: 18386042

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
In the genital tract, expressed only in male accessory glands including seminal vesicle, coagulating gland and prostate.
Database Links

KEGG: mmu:20730

STRING: 10090.ENSMUSP00000025381

UniGene: Mm.272

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*