Home
Protein
Recombinant Proteins
Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1)

Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1)

^{In Stock}

Code	CSB-YP362579MO
Abbreviation	Recombinant Mouse Spink1 protein
MSDS	MSDS Datasheet
Size	$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Spink1

Uniprot No.

P09036

Research Area

Others

Alternative Names

Spink1; Spink3; Serine protease inhibitor Kazal-type 1; P12; Prostatic secretory glycoprotein; Serine protease inhibitor Kazal-type 3

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

24-80aa

Target Protein Sequence

AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

8.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Mouse Spink1 is a recombinant protein product meticulously designed to support your scientific inquiries. This product embodies the full-length mature form of P12, alternatively known as Prostatic Secretory Glycoprotein or Serine Protease Inhibitor Kazal-type 3. It's derived from mouse species and generated through a yeast expression system, furthering its utility in a variety of research contexts.

The protein of interest spans from the 24th to the 80th amino acid region, making it an exact representation of the mature form. It features an N-terminal 6xHis-tag, which enhances its visibility and ease of purification in experimental processes. The product's purity exceeds 90% as confirmed by SDS-PAGE, ensuring its consistency and reliability. Depending on your experimental needs, you can opt for the Recombinant Mouse Spink1 in a liquid or lyophilized powder form.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.

Gene References into Functions

It is a trypsin-specific inhibitor in the pancreas. PMID: 24521862
IFN regulatory factor 2 (Irf2) has a regulatory role in trypsinogen5 gene transcription, which is resistant to a major endogenous trypsin inhibitor, Spink3 PMID: 22042864
SPINK3 modulates sperm physiology through a downstream reduction of endogenous NO concentration and independently of SPINK3 trypsin inhibitory activity. PMID: 22228629
uterine-gland-derived SPINK3, as a new paracrine modulator, might play an important role in embryo implantation through its influence on stromal decidualization in mice. PMID: 20623140
Spink3 may act as a growth factor, leading to cell proliferation and regeneration of tissue structure. PMID: 20660988
Results suggest that regulation of Prss1 and Spink3 expression is involved in the susceptibility to experimentally induced pancreatitis. PMID: 20157294
Spink3 trypsin inhibitor is required for normal pancreatic development. Data indicate an important relationship between endogenous pancreatic trypsin and Spink3 and the development of pancreatitis. PMID: 20110462
SPINK3 mRNA is upregulated in chronic pancreatitis. PMID: 15097871
Spink3 may play important roles in proliferation and/or differentiation of various cell types during development. PMID: 18386042