Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Saa2

Uniprot No.

P05367

Research Area

Others

Alternative Names

Saa2; Serum amyloid A-2 protein [Cleaved into: Amyloid protein A; Amyloid fibril protein AA)]

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

20-122aa

Target Protein Sequence

GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 20-122 constitute the expression domain of recombinant Mouse Saa2. The calculated molecular weight for this Saa2 protein is 15.6 kDa. This protein is generated in a e.coli-based system. The Saa2 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant Saa2 protein in following stages of expression and purification.

The mouse serum amyloid A-2 protein (Saa2) is a major acute-phase protein primarily produced in the liver in response to inflammatory stimuli such as infection, tissue injury, or cytokine signaling. It belongs to the serum amyloid A (SAA) family of proteins, which are involved in various immune responses and inflammatory processes. Saa2 is implicated in modulating inflammation, lipid metabolism, and the acute-phase response. Its expression is tightly regulated and can be induced by pro-inflammatory cytokines like IL-6 and TNF-α. Research on Saa2 spans areas such as inflammation, immune responses, and metabolic disorders, aiming to elucidate its role in health and disease, including its potential as a biomarker or therapeutic target for inflammatory conditions.

Target Background

Function

Major acute phase reactant.

Gene References into Functions

High level SAA expression induced amyloidosis in all mice after a short, slightly variable delay. PMID: 23959890
These results suggest that the carboxy terminus of SAA, which is highly conserved among SAA sequences in all vertebrates, might play important structural roles, including modulating the folding, oligomerization, misfolding, and fibrillation of SAA.(Saa2) PMID: 22448726
The nonpathogenic murine Saa2.2 spontaneously forms marginally stable amyloid fibrils at 37 degrees C that exhibit cross-beta structure, binding to thioflavin T, and fibrillation by a nucleation-dependent seeding mechanism. PMID: 21942925
The ability of SAA2.2 to form different oligomeric species in vitro along with its marginal stability, suggest that the structure of SAA might be modulated in vivo to form different biologically relevant species. PMID: 21439938
forms a hexamer containing a central channel in solution PMID: 12456883
Only liposomes containing intact SAA2.1 or its residues 1-20 or 74-103 promoted the efflux of cholesterol in vivo PMID: 12951366
SAA2.2 can form amyloid fibrils in vitro at physiological temperatures, which suggests that SAA2.2's inability to cause amyloidosis may be related to the stabilization of hexameric SAA2.2 and/or the slow kinetics of aberrant misfolding and self-assembly. PMID: 16194868
Many functional and pathological roles attributed to serum amyloid A may rely on its precarious structure, modulated by its interaction with ligands under homeostasis conditions and during the acute phase response. PMID: 17425332

Hide All

Involvement in disease

Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.

Subcellular Location

Secreted.

Protein Families

SAA family

Tissue Specificity

Expressed by the liver; secreted in plasma.

Database Links

KEGG: mmu:20209

STRING: 10090.ENSMUSP00000075365

UniGene: Mm.200941

Code	CSB-EP020657MO
Abbreviation	Recombinant Mouse Saa2 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Serum amyloid A-2 protein (Saa2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage