Recombinant Mouse Serum amyloid A-3 protein(Saa3)

In Stock
Code CSB-EP361411MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P04918
Relevance Major acute phase reactant. Apolipoprotein of the HDL complex.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP361411MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) SAA3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP361411MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) SAA3.
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Research Area Others
Source E.coli
Gene Names Saa3
Expression Region 20-122aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Major acute phase reactant. Apolipoprotein of the HDL complex.
Subcellular Location Secreted
Protein Families SAA family
Tissue Specificity Found in various tissues.
Database Links

KEGG: mmu:20210

STRING: 10090.ENSMUSP00000006956

UniGene: Mm.14277

Q&A and Customer Reviews

Q&A
Q:

We request pricing for the following:
500ug of CSB-EP361411MO (lot #03119), endotoxin-removal
200ug of CSB-EP361411MO (lot #03119), with endotoxin-removal performed multiple times (at least twice)
Are there any extra charges for performing endotoxin-removal twice?

A:
Sorry, we can only guarantee that the final endotoxin level is less than 1EU/ug, what's your requirement for the endotoxin level ?
We worry about that the final endotoxin level will not be extremely low even if we perform multiple times.
There isn't any extra charges for performing endotoxin-removal twice, but we can't guarantee to meet your demand.
Lead time is the same for one time or multiple times endotoxin removal operation,and there is no extra charges.
Customer Reviews

Related Products

Saa3 Antibodies

Saa3 Antibodies for Mus musculus (Mouse)

Saa3 Proteins

Saa3 Proteins for Mus musculus (Mouse)

Saa3 ELISA Kit

Saa3 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.