Recombinant Mouse Sex-determining region Y protein (Sry), partial

In Stock
Code CSB-EP022699MO
Abbreviation Recombinant Mouse Sry protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Sry
Uniprot No.
Research Area
Others
Alternative Names
Sry; Tdf; Tdy; Sex-determining region Y protein; Testis-determining factor
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-144aa
Target Protein Sequence
MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Involved in different aspects of gene regulation including promoter activation or repression. Binds to the DNA consensus sequence 5'-Constitutes the major isoform, which is necessary and sufficient for initiating male sex determination.; Constitutes a minor isoform, which is unstable due to the presence of a degron at the C-terminus that promotes its degradation. Not necessary and sufficient for initiating male sex determination.
Gene References into Functions
  1. Activation of SRY and its downstream Sox9 and PDGFRalpha pathways are commonly involved in male hepatocarcinogenesis, which provides novel insights into gender disparity and sex-specific therapeutic strategies of hepatocellular carcinoma. PMID: 28942012
  2. MAP2K6 functions in mouse testis determination, via positive effects on Sry, and a minor role for MAP2K3. PMID: 27009039
  3. our findings support that males lacking the testis determinant Sry can be fertile and reinforce the notion that Sry does not play a role in mature gonads. PMID: 26536904
  4. Variations in Usp9y and the number of CAG repeats in Sry are significantly associated with testes weight. PMID: 25716571
  5. Sry can be replaced by transgenic activation of its downstream target Sox9. This finding supports the existence of functional redundancy between the Y chromosome genes and their homologs encoded on other chromosomes. PMID: 26823431
  6. SRY binds to various ovarian differentiation genes and represses their activation through WNT/beta-catenin signaling. PMID: 25088423
  7. The SRY gene in plasma extracellular vesicles transferred to vascular endothelial cells may play an important role in the pathogenesis of atherosclerosis PMID: 25783200
  8. Studies indicate that in most of mammals, a single genetic trigger, the Y-linked gene Sry (sex determination region on Y chromosome), regulates testicular differentiation. PMID: 25139092
  9. disprove the hypothesis that the conserved HMG box domain is the only functional domain of Sry, and highlight an evolutionary paradox whereby mouse Sry has evolved a novel bifunctional module to activate Sox9 directly PMID: 25074915
  10. this study demonstrates that live mouse progeny can also be generated by using germ cells from males with the Y chromosome contribution limited to only two genes, the testis determinant factor Sry and the spermatogonial proliferation factor Eif2s3y. PMID: 24263135
  11. Microsatellite-encoded domain in rodent Sry functions as a genetic capacitor to enable the rapid evolution of biological novelty. PMID: 23901118
  12. 70-kDa heat shock cognate protein hsc70 mediates calmodulin-dependent nuclear import of the sex-determining factor SRY. PMID: 23235156
  13. Data from knockout mice suggest that spermiogenesis can be initiated whether or not second meiotic division has taken place, and even when the only Y genes present are Sry and Eif2s3y. PMID: 22869781
  14. mice lacking Gadd45gamma also exhibit XY gonadal sex reversal caused by disruption to Sry expression PMID: 23102580
  15. suggest that a signaling cascade, involving GADD45G --> p38 MAPK --> GATA4 --> SRY, regulates male sex determination PMID: 23102581
  16. Data propose that SRY/Sry may function as a male-specific maturation factor in the peri-implantation mammalian embryo. PMID: 22539273
  17. Factor SRY is the key trigger of mammalian sex determination by means of initiation the autosomal gene SOX9 expression. (Review) PMID: 22827036
  18. This study implicates Cbx2 in testis differentiation through regulating Sry gene expression. PMID: 22186409
  19. The results of this study suggest that gender indeed influences several PD-related gene expressions in VM neurons, and SRY and estrogen are involved in the different responses to oxidative stress in culture. PMID: 21919034
  20. Non-CpG methylation occurs in the regulatory region of the Sry gene. PMID: 21636956
  21. Data confirm the importance of SRY (and SRY-calmodulin complex formation) for testis differentiation and sex determination. Transport of SRY to nucleus appears to involve calmodulin. PMID: 21558314
  22. alcohol drinking was predicted by gonadal phenotype independent of sex chromosome complement. These results indicate that different alcoholism-related behaviors are determined independently by gonadal and chromosomal sex. PMID: 20610747
  23. cells expressing Sry induced proliferation of mesonephric cells migrating into male gonads, and inhibited expression of the tissue inhibitor of metalloproteinases (TIMP)-3 gene PMID: 11869290
  24. Gonadal differentiation, sex determination and normal Sry expression in mice require direct interaction between transcription partners GATA4 and FOG2 PMID: 12223418
  25. In testis diferentiation, the center-to-pole Sry expression pattern suggests the regionally distinct potencies of the genital ridge. PMID: 14517996
  26. Levels of progesterone receptors in the anteroventral periventricular nucleus, the medial preoptic nucleus, and the ventromedial nucleus were significantly higher in mice with Sry transgene, regardless of sex chromosomes PMID: 14645115
  27. expression of the Sry gene is under the control of an epigenetic mechanism mediated by DNA methylation PMID: 14978045
  28. SRY protein was detected in the Sertoli cell lineage and was swiftly down-regulated concurrently with testis cord organization PMID: 15789443
  29. the function of SIP-1/NHERF2 as an SRY cofactor during testis determination is conserved between human and mouse PMID: 16166090
  30. Identification of essential sequences of the Sry 5' upstream region that are important for the stage- and tissue-specific expression of Sry. PMID: 16182245
  31. designed a hammerhead ribozyme that could effectively cleave the target Sry mRNA in vitro PMID: 16293944
  32. Sry is specifically expressed in the substantia nigra of the adult male rodent in tyrosine hydroxylase-expressing neurons. PMID: 16488877
  33. Wt1 is located downstream of Sry and down-regulated by the sex determining gene PMID: 16571910
  34. PARP-1 represses Sry-mediated transactivation of a reporter gene in cultured cells. PMID: 16904257
  35. Sry regulation network in the development of male embryo PMID: 18244926
  36. role for KRAB-O and perhaps other KRAB genes in mediating SRY function PMID: 18588511
  37. The present study demonstrates an impact of mouse Sry on Wnt/beta-catenin signaling at an in vitro level. PMID: 18675318
  38. New insights into Sry regulation through identification of 5' conserved sequence are reorted. PMID: 18851760
  39. These results indicate the overarching importance of Sry action in the initial 6-hour phase for the female-to-male switching of FGF9/WNT4 signaling patterns. PMID: 19036799
  40. These results suggest that polymorphism of glutamine repeat within SRY correlates with the appearance of testicular oocyte and this phenotype is derived from AKR, one of the original strains of MRL mice. PMID: 19177742
  41. SRY represses the transcriptional of the Rspo1/Wnt target genes involved in ovarian determination. PMID: 19376480
  42. WT1(+KTS) is involved in the cell-autonomous regulation of Sry expression, which in turn influences cell proliferation and Sertoli cell differentiation via FGF9. PMID: 19549635
  43. The KRAB-O protein can simultaneously bind KAP1 and SRY in a noncompetitive but also noncooperative manner. PMID: 19850934
  44. This study shows that Sry expression in the B6.Ydom sex reversed mice is delayed during sex determination. It suggests that Sry must mediate its sex determining function in a critial window during mouse embryogenesis. PMID: 15789443
  45. Sry protein in the fetal gonads at the time of sex determination has first been demonstrated by western blotting and immmunostaining. PMID: 15789443
  46. A mechanism of chromatin modeling role of Sry is proposed for its function in sex determination. PMID: 16414182
  47. The Sry promoters from domesticus (Tirano) and C57BL/6 mice function similarly in embryonic and adult testes of transgenic mice. PMID: 11748612

Show More

Hide All

Subcellular Location
Nucleus speckle. Cytoplasm. Nucleus.
Protein Families
SRY family
Tissue Specificity
Expressed in gonadal somatic pre-Sertoli cells. Expressed in the substantia nigra of the brain (at protein level). Expressed in diencephalon, cortex, the substantia nigra of the midbrain and the medial mammillary bodies of the hypothalamus of male, but no
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*