Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda)

In Stock Promotion
Code CSB-EP001487MO
Size US$388
Order now
Promotion
Promotional price as low as $99
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Aicda
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Aicda; Aid; Single-stranded DNA cytosine deaminase; EC 3.5.4.38; Activation-induced cytidine deaminase; AID; Cytidine aminohydrolase
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-198aa
Target Protein Sequence
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
31.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Insertion of the gene encoding the Mouse Aicda protein (1-198aa) into a plasmid vector results in the formation of recombinant plasmid, which is then introduced into e.coli cells. Positive e.coli cells are selected relying on their ability to survive in the presence of a specific antibiotic. The e.coli cells containing the recombinant plasmid are cultured under conditions conducive to the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. Following expression, the recombinant Mouse Aicda protein is isolated and purified from the cell lysate through affinity purification. The resultant recombinant Mouse Aicda protein is analyzed using denaturing SDS-PAGE, revealing a purity greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation (SHM), gene conversion, and class-switch recombination (CSR) in B-lymphocytes by deaminating C to U during transcription of Ig-variable (V) and Ig-switch (S) region DNA. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.
Gene References into Functions
  1. AID has a role in transcription elongation for mutagenesis in B cells PMID: 29593215
  2. MMSET promotes AICDA-mediated DNA breaks at the donor switch region during immunoglobulin class switch recombination. PMID: 29158395
  3. Results indicate activation-induced cytidine deaminase (AICDA) as a driver of epigenetic heterogeneity in B-cell lymphomas with potential significance for other tumors with aberrant expression of cytidine deaminases. PMID: 29335468
  4. findings suggest that activation of Tnf-Aicda axis and co-inhibitory signals to T cells in coordination with Th1-type immunity has critical roles in the immune response against Hepatitis B virus infection PMID: 28063995
  5. the role of phosphorylation on AID serine38 in AID activity at the Immunoglobulin switch region and off-target Myc gene, is reported. PMID: 29122947
  6. Class switching correlates with replication origin activation in immunoglobulin genes;R loops contribute to the specification of origins of replication; Origin activation is independent of AID and DNA breaks PMID: 27974207
  7. The reduced expression of activation-induced cytidine deaminase (AID). PMID: 28407558
  8. this study shows that enforced expression of Sox2 in splenic B cells severely inhibits AID expression and IgH class switch recombination PMID: 28188246
  9. Aid loss in mice leads to expansion of myeloid cells and reduced erythroid progenitors resulting in anemia, with dysregulated expression of Cebpa and Gata1, myeloid/erythroid lineage-specific transcription factors PMID: 28077417
  10. UNG deficiency reduces B cell clonal expansion in the germinal center in mice and blocks the proliferation of tumor B cells expressing AID. PMID: 27697833
  11. Efficient chemoprotection of CDD and MDR1 transduced hematopoietic 32D as well as primary lin(-) cells was proven in the context of Ara-C and anthracycline application PMID: 26651614
  12. this study indicate that inflammation-induced AID expression promotes skin cancer development independently of UV damage and suggest AID as a potential target for skin cancer therapeutics. PMID: 26974156
  13. Molecular mechanism of Aid interaction with RNA-binding proteins, dimer formation and it's role in DNA-cleavage and recombination PMID: 26929374
  14. DNA methylation dynamics of germinal center B cells are mediated by AID. PMID: 26365193
  15. Demonstrate the importance of AID in generating an appropriate B1a cell response to pathogenic bacteria. PMID: 26456931
  16. AID-induced mutations are prone to generate double-strand breaks PMID: 26263206
  17. Unlike deletion of the AID C terminus, 3 of the substitution mutants reduce DNA double-strand breaks (DSBs) detected within the Sm region in splenic B cells undergoing class switch recombination . PMID: 26267846
  18. Study demonstrates that intronic switch RNA acts in trans to target AID to S region DNA. AID binds directly to switch RNA through G-quadruplexes formed by the RNA molecules. PMID: 25957684
  19. The effect of insertion of transcribed intronic S regions in a locus (Igkappa)strongly recruiting AICDA on class switch recombination is reported. PMID: 26146363
  20. Study finds AID targets somatic hypermutation (SHM) hotspots within V exon and S region passengers at similar frequencies and that the normal SHM process frequently generates deletions, indicating that SHM and class-switch recombination employ the same mechanism. PMID: 26582132
  21. Splice variants of activation induced deaminase (AID) do not affect the efficiency of class switch recombination in murine CH12F3 cells PMID: 25803053
  22. genetic deficiency in spontaneously autoimmune B6.Nba2 mice impairs production of anti-nuclear antibodies, a hallmark of systemic lupus erythematosus PMID: 25634361
  23. AID deficiency inhibits DSA-mediated aortic vasculopathy after aorta transplantation in mice. PMID: 25769064
  24. HSP90 inhibitors indirectly target AID in vivo PMID: 25912253
  25. class switch recombination is programmed to occur in a productive deletional orientation and does so via an unprecedented mechanism that involves in cis Igh organizational features in combination with frequent S-region DSBs initiated by AID PMID: 26308889
  26. Observed an activity-dependent induction of BDNF exon IV mRNA expression, which correlated with reduced DNA methylation within the BDNF P4 promoter. Knockdown of AID disrupted these effects and inhibited BDNF exon IV mRNA expression. PMID: 25041363
  27. These data suggest that Aid does not have crucial functions in DNA demethylation during induced pluripotent stem cell generation. PMID: 24718089
  28. B cell Rab7 mediates induction of activation-induced cytidine deaminase expression and class-switching in T-dependent and T-independent antibody responses. PMID: 25740947
  29. results elucidate the molecular basis of AID cytoplasmic retention, define its functional relevance and distinguish it from other mechanisms regulating AID. PMID: 25824822
  30. miR-155 controls the outcome of the the germinal center reaction by modulating its initiation (Aicda) and termination (Socs1/p53 response). PMID: 25645925
  31. AID target genes are enriched in chromatin modifications associated with active enhancers (such as H3K27Ac) and marks of active transcription (such as H3K36me3) in both fibroblasts and B cells PMID: 25512519
  32. Chronic lung injury by constitutive expression of activation-induced cytidine deaminase leads to focal mucous cell metaplasia and cancer. PMID: 25659078
  33. our results suggest a stringent and sophisticated control of Aicda by a novel IL-10/miR-155 PMID: 25381386
  34. Study reports that the majority of detectable AID off-target activity in a variety of mouse and human lymphoid or nonlymphoid cell types occurs within focal regions of overlapping sense/antisense transcription within intragenic super enhancers. PMID: 25483776
  35. AID activity and its relationship to chromosome folding and the B cell regulome was studied; find that AID-mediated lesions occur predominantly within B cell super-enhancers and regulatory clusters; further show that the structural and transcriptional features of these domains help explain AID tumorigenic activity in the B cell compartment of mice and humans. PMID: 25483777
  36. AICDA does not appear to be required for tumor development in the two virus-induced tumor mouse models. PMID: 24569264
  37. IkappaB-zeta regulates TLR-mediated CSR by inducing AID PMID: 25124037
  38. RNA exosome regulation of ncRNA recruits AID to single-strand DNA-forming sites of antisense and divergent transcription in the B-cell genome, thereby creating a link between ncRNA transcription and overall maintenance of B-cell genomic integrity PMID: 25119026
  39. Results indicate a role for apurinic/apyrimidinic endonuclease (APE) 2 (Apex2) in the protection of germinal center (GC) cells from activation-induced cytidine deaminase (AID)-independent damage. PMID: 24935922
  40. To have dominant negative (DN) function, AID lacking the C terminus (DeltaAID) must have deaminase activity, suggesting that its ability to induce double-strand breaks is important for the DN function. PMID: 24973444
  41. Activation-induced deaminase-coupled DNA demethylation is not crucial for the generation of induced pluripotent stem cells. PMID: 24083501
  42. GANP regulates the choice of DNA repair pathway by DNA-PKcs interaction in AID-dependent IgV region diversification. PMID: 24808370
  43. findings suggest that S regions are preferred targets for AID and, aided by polypyrimidine tract binding protein-2, act as "sinks" to sequester AID activity from other genomic regions. PMID: 24879790
  44. A domain of AID is required to link the DNA damage step with the subsequent repair during CSR as well as for chromosomal translocations, a collateral effect of class switch recombination. PMID: 24591601
  45. Hypoxia within spheres together with loss of Zeb1 repression synergize to cause superinduction of Hif1a, which in turn leads to induction of the DNA demethylase Aid/Aicda, demethylation of the Oct4 promoter/enhancer and multipotency. PMID: 23554223
  46. Murine Aicda(-/-) GC B cells accumulate as centrocytes and inefficiently generate plasma cells. PMID: 24244021
  47. Fate mapping and AID reporter mice were used to determine if AID expression in the mouse extends beyond lymphocytes. PMID: 23861962
  48. GANP-mediated chromatin modification promotes transcription complex recruitment and positioning at immunoglobulin variable loci to favour AID targeting. PMID: 23652018
  49. Precise regulation of the Aicda promoter appears to depend on a coordinated balance of activities between enhancer and silencer elements. PMID: 23613851
  50. studies identified a late step of reprogramming associated with methylation status, and implicated a secondary set of pluripotency network components; AID regulates this late step, removing epigenetic memory to stabilize the pluripotent state PMID: 23803762

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
Cytidine and deoxycytidylate deaminase family
Tissue Specificity
Expressed in germinal center B-cells (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*