Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), partial

Code CSB-MP733819MOd7
Abbreviation Recombinant Mouse Sptbn1 protein, partial
MSDS
Size $190
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Sptbn1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Beta-II spectrin;Embryonic liver fodrin;Fodrin beta chain
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
2199-2304aa
Target Protein Sequence
MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Fodrin, which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Gene References into Functions
  1. required for proper development of the heart PMID: 24064296
  2. The findings showed that beta-2 spectrin plays a crucial role in hepatocyte proliferation, which contributes to liver regeneration. PI3K/Akt was involved in TGFbeta/Smad signalling pathway through the interaction with Smad proteins and beta-2 spectrin. PMID: 22541060
  3. These data reveal that embryonic liver fodrin is involved in hepatic stellate cell activation and the formation of regenerative nodules derived from hepatic progenitor cells in cirrhotic liver. PMID: 21388516
  4. costamere-association of dynactin-4 did not require dystrophin but did depend on beta2 spectrin and ankyrin-B, whereas costamere association of ankyrin-B required beta2 spectrin PMID: 21186323
  5. ELF is involved in the pathogenesis of primary biliary cirrhosis and hepatocellular carcinoma. PMID: 15566516
  6. Data show that Spnb2 [beta2SP(+/-)] mice are born with many phenotypic characteristics observed in BWS patients, suggesting that beta2SP mutant mice phenocopy BWS, and beta2SP loss could be one of the mechanisms associated with BWS. PMID: 20739274
  7. downregulated expression in T cells following treatment with bis(tri-n-butylin)oxide (TBTO), an immunotoxic organotin PMID: 19552622
  8. results point to ELF as an essential adaptor protein required for key events in the propagation of TGF-beta signaling PMID: 12543979
  9. interaction between members of the ankyrin and beta-spectrin families previously established in erythrocytes and axon initial segments also occurs in neonatal cardiomyocytes with ankyrin-B and beta(2)-spectrin. PMID: 15262991
  10. In response to ELF deficiency, the abnormalities of G1/S checkpoint and senescence contribute their increment of susceptibility to malignant transformation. PMID: 16650383
  11. E-cadherin thus requires both ankyrin-G and beta-2-spectrin for its cellular localization in early embryos as well as cultured epithelial cells. PMID: 17620337
  12. ELF, a TGF-beta adaptor and signaling molecule, functions as a critical adaptor protein in TGF-beta modulation of angiogenesis as well as cell cycle progression. PMID: 18704924

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton. Endomembrane system. Cytoplasm, myofibril, sarcomere, M line.; [Isoform 2]: Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Spectrin family
Tissue Specificity
Isoform 2 is present in brain, heart, kidney and liver (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*