Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Spred1

Uniprot No.

Q924S8

Research Area

Signal Transduction

Alternative Names

Spred-1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

2-444aa

Target Protein Sequence

SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFRVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISLGCPASKTEAEGGDDDLQTTEEDTSRSLVKDHFFQQETVVTSEPYRSSDIRPLPFEDLNARRVYLQSQVSQIPFSQQGLDIQSRSMEYVQRQISKECGSLKSQTRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDTDSSVPFSKQDSKKSDYLYHCGDETKLSSLKDSVVFKTQPPSLKFKSKRRKEDGERSRCVYCQERFNHEENARGKCQDAPDPVKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

55.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow. Inhibits fibroblast growth factor (FGF)-induced retinal lens fiber differentiation, probably by inhibiting FGF-mediated phosphorylation of ERK1/2. Attenuates actin stress fiber formation via inhibition of TESK1-mediated phosphorylation of cofilin. Inhibits TGFB-induced epithelial-to-mesenchymal transition in lens epithelial cells.

Gene References into Functions

Cosuppression of Sprouty and Sprouty-related negative regulators of FGF signalling in prostate cancer PMID: 26075267
SPREDs promote self-renewal and inhibit mesodermal differentiation of murine ES cells by selective suppression of the ERK/MAPK signaling pathway in pluripotent cells PMID: 25690936
The data suggest that Spred1 negatively regulates group 2 innate lymphoid cell development and functions through the suppression of the Ras-ERK pathway. PMID: 26116510
Microrna-126 was transported into recipient human coronary artery endothelial cells by endothelial microparticles and functionally regulated the target protein sprouty-related, EVH1 domain-containing protein 1 (SPRED1). PMID: 24014835
show that neurofibromin, the NF1 gene product, is a Spred1-interacting protein that is necessary for Spred1's inhibitory function PMID: 22751498
The results suggest that Spred1 negatively regulates mast cell activation, which is modulated by miR126. PMID: 21668589
SPRED1 is a likely substrate of SHP2, whose tyrosine dephosphorylation is required to attenuate the inhibitory action of SPRED1 in the Ras/ERK pathway. PMID: 21531714
Data show that both SPRED1 and SPRED2 inhibit the ability of DYRK1A to phosphorylate its substrates. PMID: 20736167
These data suggest that Spreds are key regulators of RhoA-mediated cell motility and signal transduction. Furthermore, our study suggests that the induction of Spreds could be a novel strategy for preventing cancer cell metastasis. PMID: 15184877
role in hematopoiesis PMID: 15465815
Spred-1 and Spred-2 were found to be expressed predominantly in brain PMID: 15580519
Spred-1 negatively regulates allergen-induced airway eosinophilia and hyperresponsiveness by modulating IL-5 signaling in allergic asthma, without affecting helper T cell differentiation PMID: 15630138
We show here that Spred-1 and Spred-2 appear to have distinct mechanisms whereby they induce their effects, as the Sprouty domain of Spred-1 is not required to block MAPK (mitogen-activated protein kinase) activation, while that of Spred-2 is required. PMID: 15683364
These data suggest that Spred-1 inhibits ERK activation in collaboration with Cav-1 PMID: 16115197
Spred1 is essential for embryonic lymphangiogenesis by regulating VEGFR3 signaling. PMID: 17438136
Spred1 is required for synaptic plasticity and hippocampus-dependent learning. PMID: 19118178
TGF-beta mediates an inhibitory mechanism on CD8+ TILs involving TCR-signaling blockade and the upregulation of Spred-1. PMID: 19319531
Spred1 is critical for normal cortical development, as it modulates progenitor self-renewal/proliferation and helps maintain the integrity and organization of germinal zones PMID: 20047999

Hide All

Subcellular Location

Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Nucleus.

Tissue Specificity

Expressed in brain. Weakly expressed in lung, heart, liver, kidney, intestine, spleen, testis, thymus, colon and ovary. Also expressed in embryonic tissues such as heart, lung, liver and brain. Highly expressed in IL3-dependent hematopoietic cell lines (B

Database Links

KEGG: mmu:114715

STRING: 10090.ENSMUSP00000028829

UniGene: Mm.245890

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP835669MO
Abbreviation	Recombinant Mouse Spred1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Sprouty-related, EVH1 domain-containing protein 1 (Spred1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage