Product Details

Purity

>85% (SDS-PAGE)

Target Names

Tbpl1

Uniprot No.

P62340

Alternative Names

Tbpl1; Tlf; Tlp; Tlp21; Trf2; Trp; TATA box-binding protein-like protein 1; TBP-like protein 1; 21 kDa TBP-like protein; TATA box-binding protein-related factor 2; TBP-related factor 2; TBP-like factor; TBP-related protein

Species

Mus musculus (Mouse)

Expression Region

1-186

Target Protein Sequence

MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE SRKEIL

Protein Length

Full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Part of a specialized transcription system that mediates the transcription of most ribosomal proteins through the 5'-TCT-3' motif which is a core promoter element at these genes. Seems to also mediate the transcription of NF1. Does not bind the TATA box.

Gene References into Functions

Trf2 forms a stable complex with TFIIA or the testis expressed paralogue ALF chaperoned in the cytoplasm by heat shock proteins. It is recruited to active haploid cell promoters together with Tbp, Taf7l and RNA polymerase II. A set of genes activated in haploid spermatids during the first wave of spermatogenesis is down-regulated by Trf2 inactivation. PMID: 27576952
Overexpression and knockdown of TLP revealed that the levels of muscle-specific myosin heavy chain and the myogenic transcription factor myogenin are downregulated by TLP. The proximal AT-rich sequence of the myogenin promoter is responsible for TLP-mediated transcriptional repression. PMID: 27680312
Transplantation of TRF2 overexpressing bone marrow cells into the hematopoietic system of mice resulted in the the development of T-cell lymphomas, but overexpression of the TRF2 transgene was not detectable anymore in the tumors. PMID: 20046894
transcription factor IIA may regulate the intracellular molecular state and the function of TATA-binding protein-like protein (TLP) through its property of binding to TLP PMID: 14570910
TBP-related factor 2 (TRF2) has a role in mouse spermatogenesis PMID: 14967955
reconfirmed cytoplasmic localization of TRF2; genotoxins caused it to migrate to the nucleus; TRF2 may be involved in genotoxin-induced transcriptional regulation PMID: 17085973
these results demonstrate that TRF2 increased expression is a potent oncogenic event that along with telomerase deficiency accelerates carcinogenesis, coincidental with a derepression of telomere recombination PMID: 17234886
Role of TRF2 mRNA in male germ cells: In transgenic animals deficient in TRF2, spermatid development fails during early spermiogenesis with increased apoptosis and failure to develop testicular spermatozoa. Infertility phenotype in homozygote males. PMID: 11352070
Mice lacking the TBP-related factor 2 (TRF2) gene, which is highly expressed in the testis, have a severe defect in spermiogenesis. TRF2 expression is shown to be cell type- and stage-specific and play an essential regulatory role in development. PMID: 11472857

Hide All

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

TBP family

Tissue Specificity

Ubiquitously expressed.

Database Links

KEGG: mmu:237336

STRING: 10090.ENSMUSP00000093470

UniGene: Mm.86670

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-YP023240MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP023240MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP023240MO-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP023240MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP023240MO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse TATA box-binding protein-like protein 1 (Tbpl1)

Product Details

Customer Reviews and Q&A

Target Background

×CloseMessage