Recombinant Mouse Tenascin (Tnc), partial

In Stock
Code CSB-MP768917MO
Abbreviation Recombinant Mouse Tnc protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Tnc was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Tnc; Hxb; Tenascin; TN; Hexabrachion; Tenascin-C; TN-C
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1884-2099aa
Target Protein Sequence
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Mouse Tenascin (Tnc) comes from a mammalian cell expression system and represents a partial protein spanning amino acids 1884-2099. The protein carries both an N-terminal 10xHis-tag and a C-terminal Myc-tag, which should make purification and detection more straightforward. SDS-PAGE analysis indicates the purity exceeds 85%, suggesting it's well-suited for laboratory work. This product is for research use only.

Tenascin appears to be a key extracellular matrix protein with important roles in how tissues develop and repair themselves. The protein seems to influence cell signaling pathways that control how cells stick together, move around, and differentiate into specialized types. Developmental biologists and cancer researchers pay particular attention to tenascin since its expression patterns often change dramatically in these contexts. Studying how this protein works and what it interacts with might reveal important details about these biological processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Tnc is a large extracellular matrix glycoprotein that requires precise folding, proper domain organization, and specific tertiary structure for its functional activity in cell adhesion and migration. The mammalian cell expression system provides the eukaryotic folding environment necessary for correct disulfide bond formation and potential glycosylation. However, the partial fragment (1884-2099aa, 216aa) represents only a small portion of the full-length protein (∼2200aa) and lacks the complete structural context. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may cause steric interference with the protein's functional domains. While mammalian expression favors proper folding, the probability of correct folding with functional bioactivity requires experimental validation due to the truncated nature.

1. Antibody Development and Validation Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition. The mammalian-expressed fragment provides proper folding and relevant post-translational modifications within this specific region. However, antibodies may not recognize conformational epitopes of the full-length, properly assembled tenascin protein in its native extracellular matrix context.

2. Protein-Protein Interaction Studies

This application carries a significant risk without functional validation. Tenascin interactions with integrins and other ECM components require precise tertiary structure and proper domain conformation. If correctly folded (verified), the fragment may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine extracellular matrix interactions.

3. Biochemical Characterization and Structural Studies

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and thermal stability assays. However, results will describe this specific fragment rather than the full-length tenascin protein.

4. Cell Adhesion and Migration Assays

This application carries high risk without functional validation. Tenascin's cell adhesion properties require specific integrin-binding domains and proper tertiary structure. If correctly folded and active (verified), limited adhesion studies may be possible. If misfolded/inactive (unverified), cell behavior data will be biologically misleading.

Final Recommendation & Action Plan

The mammalian-expressed Tnc fragment with dual tags may be properly folded due to the appropriate expression system, but its functional applications are severely limited by the small size (216aa represents only ∼10% of the full-length protein) and lack of complete structural context. Begin with Application 3 (Biochemical Characterization) to validate folding quality through CD spectroscopy and SEC. Application 1 (antibody development) can proceed immediately. Applications 2 and 4 require rigorous functional validation using cell adhesion and binding assays before consideration. For reliable tenascin research, use larger domain constructs or full-length protein expressed in mammalian systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.
Gene References into Functions
  1. TNC causes post-subarachnoid hemorrhage neuronal apoptosis and neuroinflammation. PMID: 29546590
  2. Results identify tenascin-C as an endogenous danger signal that is upregulated in systemic sclerosis and drives TLR4-dependent fibroblast activation, and by its persistence impedes fibrosis resolution. PMID: 27256716
  3. ATF3 promotes macrophage migration and reverses M1polarized macrophages to the M2 phenotype by upregulation of TNC via the Wnt/betacatenin signaling pathway. PMID: 28714032
  4. housing of TnC-/- mice in enriched environment abolished hyperlocomotion, led to faster habituation to novel environment, strengthened the grasp of fore limbs and partially improved movement coordination, while the swimming ability remained deficient PMID: 28549651
  5. The synaptic plasticity occurs in the hippocampus of freely behaving mice that lack tenascin-C, the informational content stored by synaptic plasticity is not the same. PMID: 28512860
  6. Study suggests that tenascin-C (TnC) contributes to the regulation of structural plasticity in the cerebellum and that interactions between TnC and matrix metalloproteinase 9 are likely to be important for these processes to occur. PMID: 27089885
  7. the exact role of TNC in primary tumor growth PMID: 28874093
  8. A deficiency of tenascin C interferes with Th1 and Th17 cells, protecting animals from experimental autoimmune encephalomyelitis. PMID: 27974153
  9. secreted by transdifferentiated retinal pigment epithelial cells and promotes the development of choroidal neovascularization via integrin alphaV in a paracrine manner PMID: 27668890
  10. Tenascin-C may be an important mediator in the development of brain edema and blood-brain barrier disruption following subarachnoid hemorrhage, mechanisms for which may involve MAPK-mediated MMP-9 induction and ZO-1 degradation PMID: 26473781
  11. TN-C aggravates autoimmune myocarditis by driving the dendritic cell activation and Th17 differentiation via toll-like receptor 4. PMID: 25376187
  12. TNC supports the stress-induced expression of extracellular matrix that reinforce the aorta and the stress-induced excessive inflammatory response in the aorta. PMID: 24514259
  13. TNC plays an important role in TMJ wound healing, especially for wounds generated by mechanical stress. PMID: 25578971
  14. Tenascin-C is required for normal Wnt/beta-catenin signaling in the whisker follicle stem cell niche. PMID: 25196097
  15. TNC downregulates Dickkopf-1 (DKK1) promoter activity through the blocking of actin stress fiber formation, activates Wnt signaling, and induces Wnt target genes in tumor and endothelial cells. PMID: 24139798
  16. The increased levels of elastin, type V collagen and tenascin C are probably the result of increased expression by fibroblastic cells; reversely, elastin influences myofibroblast differentiation PMID: 24291458
  17. Elevated tenascin-C expression in globoid cell leukodystrophy modified microglial functional response to psychosine. PMID: 25192051
  18. Tenascin-C-derived peptide TNIIIA2 highly enhances cell survival and platelet-derived growth factor (PDGF)-dependent cell proliferation through potentiated and sustained activation of integrin alpha5beta1. PMID: 24808173
  19. FHL2-deficient mice developed a severe and long-lasting lung pathology due to enhanced expression of tenascin C and impaired activation of inflammation-resolving macrophages. PMID: 24260575
  20. the CD34-positive whisker follicle stem cell niche contains both tenascin-C and tenascin-W, and these glycoproteins might play a role in directing the migration and proliferation of these stem cells PMID: 24101721
  21. It is upregulated in inflammation and induces further inflammatory responses and the functional inhibition exerts beneficial effects on AD pathogenesis, suggesting a potential for tnc as a new therapeutic target in AD. PMID: 23673309
  22. Tenascin C did not play an essential role in stem and progenitor cell homing to BM, but significantly altered lymphoid primed progenitor cell homing PMID: 24084079
  23. TNC does not appear to contribute directly to outflow resistance in the eye. PMID: 23882691
  24. TNC expression controls eotaxin level in apo E-/- mice; this chemokine plays a key role in the development of atherosclerosis PMID: 23433402
  25. This study provided evidence that the tenascin-c modulates synaptogenesis and long-term synapse stability. The mutant neurons display reduced frequencies of mEPSCs and mIPSCs. PMID: 23637166
  26. cleavage by gingipains directly affects the biological activity of both fibronectin and tenascin-C in a manner that might lead to increased cell detachment and loss during periodontal disease. PMID: 23313574
  27. Tenascin-C enables macrophage translation of proinflammatory cytokines upon lipopolysaccharide activation of toll-like receptor 4 (TLR4) and suppresses the synthesis of anti-inflammatory cytokines. PMID: 23084751
  28. These data unveil a protective role for tenascin C (TNC) in atherosclerosis and suggest that TNC signaling may have the potential to reduce atherosclerosis, in part by modulating VCAM-1 expression. PMID: 22300502
  29. TNC is involved in the etiopathology of obesity via visceral adipose tissue inflammation representing a link with extracellular matrix remodeling. PMID: 22851489
  30. Both cycling G2-phase cells and early post-mitotic neurons were significantly increased in the retina due to Tnc-deficiency. Further investigations suggested that Tnc regulates these processes via the Wnt-signaling cascade. PMID: 22691363
  31. This study provided evidence that the tenascin-C affect the repair of the blood-spinal cord barrier repair in soinal cord injury. PMID: 22473292
  32. Mice lacking TN-C (TN-C(-/-)) mice showed normal steady-state hematopoiesis; however, they failed to reconstitute hematopoiesis after bone marrow ablation and showed high lethality. PMID: 22553313
  33. data establish a role for BMP, Wnts, and mechanical loading in the regulation of tenascin expression in osteoblasts PMID: 21751239
  34. Tnc deficiency interfered with VCAM-1 vascular deposition and down-regulation of PECAM-1, disrupted MMP-9-positive leukocyte infiltration, hampered apoptosis and necrosis, and favored liver repair/regeneration after ischemia-reperfusion injury. PMID: 21898491
  35. TN-C may be a useful biomarker for indicating the pathological status of smooth muscle cells and interstitial cells in abdominal aortic aneurysm. PMID: 21951663
  36. The data implicated tenascin C in the regulation of proliferation and lineage progression of astroglial progenitors in specific domains of the developing spinal cord. PMID: 22071102
  37. Data show that reduction in metastasis due to the loss of S100A4(+) fibroblasts correlated with a concomitant decrease in the expression of several ECM molecules and growth factors, particularly Tenascin-C and VEGF-A. PMID: 21911392
  38. Promoter-reporter and chromatin immunoprecipitation experiments unraveled a SAP-dependent, SRF-independent interaction of MKL1 with the proximal promoter region of TNC. PMID: 21705668
  39. Tenascin-C is expressed in neural stem cells and neural cells derived from embryonic stem cells where it is expected to have a specific functional role in facilitating nervous tissue repair and regeneration. PMID: 20689858
  40. Study suggests a new role of tenascin-C as a regulator of the fibrinolytic system. PMID: 21354146
  41. Overexpression of TNC-fnD via adeno-associated virus in wild-type mice improved locomotor recovery, increased monaminergic axons sprouting, and reduced lesion scar volume after spinal cord injury. PMID: 20606643
  42. HNK-1 epitope-carrying tenascin-C spliced variant regulates the proliferation of mouse embryonic neural stem cells. PMID: 20855890
  43. Tenascin-C is required for injury-induced epithelial-mesenchymal transition in the mouse lens epithelium. PMID: 20664686
  44. Mechanisms are presented of the first signaling pathways that underlie Tnc-induced, extracellular matrix-dependent maintenance of the immature state of oligodendendrocyte precursor cells. PMID: 20844127
  45. Tenascin-C may thus accelerate adverse ventricular remodeling, cardiac failure, and fibrosis in the residual myocardium after myocardial infarction. PMID: 20081106
  46. Here we show that periostin, a matricellular protein, promotes incorporation of tenascin-C into the extracellular matrix and organizes a meshwork architecture of the extracellular matrix. PMID: 19887451
  47. These findings indicate a role for tenascin-C in structural organization of the CA1 hippocampal subfield and in shaping neural activity. PMID: 19280660
  48. results suggested that the isoforms containing one or five alternatively spliced domains play important roles in the healing process of glomerulonephritis PMID: 12009782
  49. TN-C is involved in hippocampus-dependent contextual memory and synaptic plasticity; the FN6-8 domain is one of molecular determinants mediating these functions. PMID: 12359159
  50. TN-C induces MMP-9 expression directly and by collaboration with TGF-beta in breast cancer progression PMID: 12672030

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Tenascin family
Tissue Specificity
Expressed in kidney, aortic valve, corneal limbus, periosteum around the ribs, cerebellum, stomach and intestine. High levels of isoform 2 in lung and brain of newborn mice. High levels of isoform 5 in thymus, moderate levels in brain of newborn and adult
Database Links

KEGG: mmu:21923

UniGene: Mm.454219

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*