Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Tnmd

Uniprot No.

Q9EP64

Research Area

Others

Alternative Names

Tnmd; Chm1l; Tenomodulin; TeM; mTeM; Chondromodulin-1-like protein; ChM1L; mChM1L; Chondromodulin-I-like protein; Myodulin; Tendin

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

51-317aa

Target Protein Sequence

KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.1 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Mouse Tnmd Protein is encoded by Tnmd gene — recombinant Tnmd DNA — that has integrated foreign plasmids into the Yeast genome, the foreign DNA is replicated along with the host DNA. In addition, the expression of foreign proteins requires the use of specialized expression vectors and often necessitates the significant restructuring of the foreign coding sequence. The subsequent expression process includes small-scale expression, protein identification, large-scale expression, and protein purification. The purity of this recombinant Tnmd is 85%+.

Tnmd (also known as Chm1l) is a gene encoding a protein named tenomodulin (short name is TeM) or chondromodulin-1-like protein (short name is ChM1L). The protein encoded by this gene, also referred to as tendin or myodulin, was discovered as a gene sharing high similarity with the already known chondromodulin-1 in 2001. It is a type II transmembrane protein characteristically expressed in dense connective tissues, such as tendons and ligaments. Currently, this protein has been reported as a tendon/ligament-specific marker and anti-angiogenic factor with abundant expression in the intervertebral disc (IVD).

Target Background

Function

May be an angiogenesis inhibitor.

Gene References into Functions

Tnmd is required for prevention of adipocyte accumulation and fibrovascular scar formation during early tendon healing. PMID: 29022912
The results of enhanced tenogenic differentiation and neotendon formation indicated that Tnmd may serve not only as a tenogenic marker but also as a positive regulator of MSCs tenogenic differentiation, which might be applied to MSCs-mediated tendon regeneration. PMID: 27098985
our study demonstrates that Tnmd is required for proper tendon tissue adaptation to endurance running and aids in better understanding of the structural-functional relationships of tendon tissues. PMID: 28566251
In vitro comparison of tenogenic differentiation potentials among bone marrow derived stem cells (BMSCs), adipose derived stem cells (ASCs), dermal fibroblasts (DFs) and tenocytes (TCs) of the same Tnmd transgenic mice. BMSCs exhibited the best tenogenic potential than other three cell types. PMID: 27777108
Upon high-fat diet feeding, transgenic mice overexpressing Tnmd develop increased epididymal white adipose tissue (eWAT) mass, and preadipocytes derived from Tnmd transgenic mice display greater proliferation, consistent with elevated adipogenesis. PMID: 26880110
Loss of Tnmd affects significantly the self-renewal and senescence properties, but not the multipotential of tendon stem cells. PMID: 25351164
In our study of MM development, the laminar structure regulating TeM also prevents vascular invasion during the formation of compartment of the MM. PMID: 25107480
Results suggest that tenomodulin (Tnmd) is a regulator of tenocyte proliferation and is involved in collagen fibril maturation but do not confirm an in vivo involvement of Tnmd in angiogenesis. PMID: 15632070
The expression domains of ChM-I and TeM during vertebrate development incorporate the typical avascular regions of the mesenchymal tissues. PMID: 18239943
Tenomodulin is expressed abundantly in the elastin-rich subendothelial outer layer of the normal chordae tendineae cordis. PMID: 18838562

Hide All

Subcellular Location

Membrane; Single-pass type II membrane protein. Nucleus envelope.

Protein Families

Chondromodulin-1 family

Tissue Specificity

Widely expressed with highest expression in tendons and ligaments, in the diaphragm, eye and skeletal muscle. Expressed in neuronal cells of all brain regions. Very low expression, if any, in glial cells.

Database Links

KEGG: mmu:64103

STRING: 10090.ENSMUSP00000033602

UniGene: Mm.46221

Code	CSB-YP024007MO
Abbreviation	Recombinant Mouse Tnmd protein, partial
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Tenomodulin (Tnmd), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage