Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Tnmd; Chm1l; Tenomodulin; TeM; mTeM; Chondromodulin-1-like protein; ChM1L; mChM1L; Chondromodulin-I-like protein; Myodulin; Tendin
Species
Mus musculus (Mouse)
Expression Region
51-317aa
Target Protein Sequence
KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3
working days after receiving your orders. Delivery time may differ from different purchasing way or
location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with
normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Mouse Tnmd Protein is encoded by Tnmd gene — recombinant Tnmd DNA — that has integrated foreign plasmids into the Yeast genome, the foreign DNA is replicated along with the host DNA. In addition, the expression of foreign proteins requires the use of specialized expression vectors and often necessitates the significant restructuring of the foreign coding sequence. The subsequent expression process includes small-scale expression, protein identification, large-scale expression, and protein purification. The purity of this recombinant Tnmd is 85%+.
Tnmd (also known as Chm1l) is a gene encoding a protein named tenomodulin (short name is TeM) or chondromodulin-1-like protein (short name is ChM1L). The protein encoded by this gene, also referred to as tendin or myodulin, was discovered as a gene sharing high similarity with the already known chondromodulin-1 in 2001. It is a type II transmembrane protein characteristically expressed in dense connective tissues, such as tendons and ligaments. Currently, this protein has been reported as a tendon/ligament-specific marker and anti-angiogenic factor with abundant expression in the intervertebral disc (IVD).
