Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12)

In Stock
Code CSB-EP887432MO
Abbreviation Recombinant Mouse Txndc12 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Txndc12
Uniprot No.
Research Area
Others
Alternative Names
Txndc12; Tlp19; Thioredoxin domain-containing protein 12; EC 1.8.4.2; Endoplasmic reticulum resident protein 19; ER protein 19; ERp19; Thioredoxin-like protein p19
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-170aa
Target Protein Sequence
RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) is produced in E. coli and includes an N-terminal 6xHis-tag that makes purification more straightforward. The protein covers the complete mature protein sequence from amino acids 25 to 170. Purification achieves greater than 90% purity based on SDS-PAGE analysis, which appears to provide reliable quality for research work.

Thioredoxin domain-containing protein 12 (Txndc12) participates in redox homeostasis within cells. It seems to play an important role in keeping the cellular redox environment balanced, helping reduce disulfide bonds in proteins. Txndc12 belongs to the thioredoxin family, which is likely essential for antioxidant defense systems and cellular signaling networks. This makes it a compelling target for studying oxidative stress and related cellular mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-tagged recombinant mouse Txndc12 can be attached to nickel-affinity resins to capture potential binding partners from mouse cell lysates or tissue extracts. This method may help reveal the molecular networks where Txndc12 operates in cellular processes. The high purity (>90%) should minimize background noise from contaminating proteins. Mass spectrometry analysis of captured complexes could uncover previously unknown interacting proteins and shed light on what Txndc12 actually does in cells.

2. Antibody Development and Validation

This recombinant protein works well as an immunogen for creating mouse Txndc12-specific antibodies in rabbits or other host animals. The mature protein region (25-170aa) represents what's found naturally, making it appropriate for producing antibodies that recognize the native form. The His-tag helps with protein purification during immunization procedures and later antibody testing through ELISA-based binding experiments. These antibodies could then be tested for use in Western blotting, immunoprecipitation, or immunofluorescence applications.

3. Biochemical Characterization and Structural Studies

The purified recombinant Txndc12 enables detailed biochemical analysis, including measuring protein stability, folding characteristics, and thermal breakdown patterns. Circular dichroism spectroscopy might reveal details about the secondary structure of this thioredoxin domain-containing protein. Researchers can test how the protein behaves under different buffer conditions, pH levels, and salt concentrations. These experiments would help determine the best conditions for storing and handling the protein in research settings.

4. Comparative Functional Analysis Across Species

This mouse Txndc12 protein can act as a reference point for comparing Txndc12 versions from other species. Testing cross-reactivity with antibodies developed against human or rat Txndc12 may show how well epitopes are conserved through evolution. The recombinant protein allows direct comparison of biochemical characteristics between different species variants. Such comparative work could reveal species-specific functional differences and evolutionary connections within the broader thioredoxin domain-containing protein family.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possesses significant protein thiol-disulfide oxidase activity.
Gene References into Functions
  1. both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues PMID: 12930873
  2. ERp16 mediates disulfide bond formation in the ER and plays an important role in cellular defense against prolonged ER stress PMID: 18628206
Subcellular Location
Endoplasmic reticulum lumen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*