Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12)

In Stock
Code CSB-YP887432MO
Abbreviation Recombinant Mouse Txndc12 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Txndc12
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Txndc12; Tlp19; Thioredoxin domain-containing protein 12; EC 1.8.4.2; Endoplasmic reticulum resident protein 19; ER protein 19; ERp19; Thioredoxin-like protein p19
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
25-170aa
Target Protein Sequence
RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) is produced using a yeast expression system. The protein represents the full length of the mature form, spanning amino acids 25 to 170. It comes with an N-terminal 6xHis tag, which appears to simplify both purification and detection processes. SDS-PAGE analysis suggests the product achieves greater than 90% purity, making it potentially useful for various experimental approaches.

Thioredoxin domain-containing protein 12 (Txndc12) seems to participate in cellular redox processes. It likely plays an important role in maintaining redox homeostasis within cells. The protein belongs to the thioredoxin family, which appears essential for reducing oxidative stress and may function as a key component in cellular signaling pathways. Understanding this protein could provide insights into redox biology and its role in both normal physiology and disease states.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant mouse Txndc12 (25–170aa) expressed in yeast with an N-terminal 6×His tag represents the full-length mature protein, which substantially increases the likelihood of proper folding and native-like bioactivity. Txndc12 is a thioredoxin domain-containing protein localized in the endoplasmic reticulum, and its folding depends on the formation of correct disulfide bonds—a process yeast expression systems can usually support. Therefore, it is highly probable that this recombinant protein is folded correctly and retains partial or full enzymatic and binding activity characteristic of native Txndc12. However, experimental validation is still necessary to confirm functional integrity before using it for mechanistic or structural studies.

1. Protein-Protein Interaction Studies

This N-terminal 6×His-tagged Txndc12 can be used in pull-down or affinity assays to explore potential binding partners involved in endoplasmic reticulum protein folding or redox regulation pathways. The tag facilitates immobilization on nickel matrices, and the >90% purity supports reproducibility in interaction assays. If the protein is correctly folded, it can identify physiological binding partners through its functional thioredoxin domain. If misfolded, it can still serve for preliminary screening but may not reflect authentic interactions, since disulfide-dependent conformations are essential for Txndc12 function. Thus, folding validation should precede high-confidence interaction studies.

2. Antibody Development and Validation

The recombinant full-length mature Txndc12 (25–170aa) is well-suited for producing specific antibodies recognizing the native protein. Its high purity and defined domain coverage ensure epitope accessibility. If correctly folded, antibodies generated against this antigen are likely to recognize both native and denatured forms of Txndc12. If misfolded, it will still serve as an effective linear-epitope immunogen for Western blot or ELISA but may not yield antibodies that bind conformational epitopes in immunocytochemistry or immunoprecipitation. Thus, it is suitable for antibody generation but requires validation of native binding specificity.

3. Structural and Biochemical Characterization

This recombinant protein is a strong candidate for structural and biophysical studies, given it represents the full-length mature form and is likely properly folded in yeast. It can be used for CD spectroscopy, DLS, or redox potential measurements to assess structure and enzymatic behavior. If folding and homogeneity are confirmed, it could be extended to X-ray crystallography or NMR for detailed structural studies. If folding is uncertain, it should be used only for secondary structure or stability analysis, not for atomic-level structural determination.

4. ELISA-Based Quantitative Assays

The His-tagged Txndc12 can be effectively used as a standard or capture reagent in ELISA assays to quantify Txndc12 expression levels in mouse samples. The >90% purity supports accurate quantitation with minimal nonspecific binding. If folded correctly, it provides a biologically relevant standard for quantifying native Txndc12. If misfolded, it can still function as a reference antigen for antibody calibration in denatured or tag-based ELISA formats.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possesses significant protein thiol-disulfide oxidase activity.
Gene References into Functions
  1. both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues PMID: 12930873
  2. ERp16 mediates disulfide bond formation in the ER and plays an important role in cellular defense against prolonged ER stress PMID: 18628206
Subcellular Location
Endoplasmic reticulum lumen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*