Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12)

In Stock
Code CSB-YP887432MO
Abbreviation Recombinant Mouse Txndc12 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Txndc12
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Txndc12; Tlp19; Thioredoxin domain-containing protein 12; EC 1.8.4.2; Endoplasmic reticulum resident protein 19; ER protein 19; ERp19; Thioredoxin-like protein p19
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
25-170aa
Target Protein Sequence
RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) is produced using a yeast expression system. The protein represents the full length of the mature form, spanning amino acids 25 to 170. It comes with an N-terminal 6xHis tag, which appears to simplify both purification and detection processes. SDS-PAGE analysis suggests the product achieves greater than 90% purity, making it potentially useful for various experimental approaches.

Thioredoxin domain-containing protein 12 (Txndc12) seems to participate in cellular redox processes. It likely plays an important role in maintaining redox homeostasis within cells. The protein belongs to the thioredoxin family, which appears essential for reducing oxidative stress and may function as a key component in cellular signaling pathways. Understanding this protein could provide insights into redox biology and its role in both normal physiology and disease states.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies

This N-terminal 6xHis-tagged Txndc12 might work well in pull-down assays to identify potential binding partners. It could also help validate known interactions with other proteins involved in endoplasmic reticulum function or protein folding pathways. The high purity level (>90%) suggests it would be suitable for co-immunoprecipitation experiments or surface plasmon resonance studies. The His-tag allows for immobilization on nickel-based matrices, which may be useful for systematic screening of protein libraries or cell lysates.

2. Antibody Development and Validation

The recombinant protein appears to be an ideal antigen for generating mouse Txndc12-specific antibodies in rabbits or other host species. Since the mature protein region (25-170aa) represents the functional domain, it seems appropriate for producing antibodies that would recognize the native protein in research applications. The His-tag could also be helpful for developing tag-specific detection methods during experimental validation.

3. Structural and Biochemical Characterization

This purified recombinant protein may prove useful for biophysical studies. These could include circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation to characterize its folding state and oligomerization properties. Yeast expression systems typically produce properly folded eukaryotic proteins, which suggests this would be suitable for structural studies. The defined expression region (25-170aa) allows researchers to focus their analysis on the thioredoxin domain structure and stability.

4. ELISA-Based Quantitative Assays

The His-tagged Txndc12 could serve as a standard or capture reagent in enzyme-linked immunosorbent assays. This might allow researchers to measure Txndc12 levels in mouse tissue extracts or cell culture samples. The high purity should provide reliable quantitative measurements with minimal background interference. This application may be particularly valuable for studies investigating Txndc12 expression patterns across different mouse tissues or under various experimental conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Possesses significant protein thiol-disulfide oxidase activity.
Gene References into Functions
  1. both ERp19 and ERp46 and their respective mRNAs are highly expressed in the liver as compared with other tissues PMID: 12930873
  2. ERp16 mediates disulfide bond formation in the ER and plays an important role in cellular defense against prolonged ER stress PMID: 18628206
Subcellular Location
Endoplasmic reticulum lumen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*