Recombinant Mouse Toll-like receptor 11 (Tlr11), partial

In Stock
Code CSB-EP764846MO
Abbreviation Recombinant Mouse Tlr11 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Tlr11
Uniprot No.
Research Area
Immunology
Alternative Names
Toll-like receptor 12
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
769-926aa
Target Protein Sequence
RGQFNYDVFISYCEEDQAWVLEELVPVLEKAPPEGEGLRLCLPARDFGIGNDRMESMIASMGKSRATLCVLTGQALASPWCNLELRLATYHLVARPGTTHLLLLFLEPLDRQRLHSYHRLSRWLQKEDYFDLSQGKVEWNSFCEQLKRRLSKAGQERD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 769-926 constitute the expression domain of recombinant Mouse Tlr11. This Tlr11 protein is expected to have a theoretical molecular weight of 25.7 kDa. The Tlr11 protein was expressed in e.coli. The Tlr11 gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Tlr11 protein during the following stages.

The mouse Toll-like receptor 11 (Tlr11) is a member of the Toll-like receptor (TLR) family, a group of pattern recognition receptors that play a crucial role in the innate immune system. TLRs recognize conserved molecular patterns on pathogens, activating immune responses. Tlr11 is unique to rodents, and its function is particularly important in recognizing uropathogenic bacteria. Upon ligand binding, Tlr11 activates signaling pathways leading to the production of pro-inflammatory cytokines and type I interferons, contributing to the host defense against bacterial infections. Understanding the role of Tlr11 in the immune response provides insights into the mechanisms of pathogen recognition and may have implications for developing strategies to modulate immune responses in infectious diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Gene References into Functions
  1. mechanisms of interaction with flagellin and profilin PMID: 26859749
  2. Data show that TLR11 expression is induced in astrocytes, neurons, and microglia in the immune response to T. gondii infection PMID: 24704432
  3. TLR11 mediates innate immune function of male germ cells in response to T. gondii profilin and uropathogenic escherichia coli stimulations. PMID: 24403550
  4. Biochemical experiments revealed that TLR11 and TLR12 directly bind to Toxoplasma gondii profilin and are capable of forming a heterodimer complex. PMID: 24078692
  5. Selective elimination of neutrophils in TLR11-deficient mice infected with Toxoplasma gondii results in acute susceptibility similar to that observed in IFN-gamma-deficient mice. PMID: 23754402
  6. a potentially important role for TLR11 in preventing murine intestinal infection and modulating antigen transportation in the gut and imply an important role for various TLRs in cooperation with tight control of pathogens penetrating into Peyer patches. PMID: 23135279
  7. association with UNC93B1 and the intracellular localization of TLRs are not unique features of nucleic acid-sensing TLRs but is also essential for TLR11-dependent recognition of T. gondii profilin and for host protection against this parasite PMID: 21097503
  8. Data demonstrate that transcription of the Tlr11 gene is regulated through epithelium-specific transcription factors and IRF-8. PMID: 19801549
  9. displays a distinct pattern of expression in macrophages and liver, kidney, and bladder epithelial cells; mice lacking TLR11 are highly susceptible to infection of the kidneys by uropathogenic bacteria PMID: 15001781
  10. Toxoplasma gondii profilin activates dendritic cells through TLR11 and is the first chemically defined ligand for this TLR; TLR11 is required in vivo for parasite-induced IL-12 production and optimal resistance to infection PMID: 15860593
  11. The immunogenicity of Toxoplasma gondii profilin was entirely dependent on both TLR11 recognition and signaling through the adaptor myeloid differentiation factor 88 (MyD88). PMID: 17000122
  12. TLR11-deficient mice develop an abnormal immunopathological response to Toxoplasma gondii, as the result of non-toll-like receptor dependent activation of interferon-gamma secretion by natural killer cells in response to the infection. PMID: 19050265
  13. TLRs 11-13 are expressed in normal and parasite infected mouse brains. This suggests a role for them in central nervous system infections. PMID: 19077284

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Toll-like receptor family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*