Purity
Greater than 90% as determined by SDS-PAGE.
Species
Mus musculus (Mouse)
Expression Region
769-926aa
Target Protein Sequence
RGQFNYDVFISYCEEDQAWVLEELVPVLEKAPPEGEGLRLCLPARDFGIGNDRMESMIASMGKSRATLCVLTGQALASPWCNLELRLATYHLVARPGTTHLLLLFLEPLDRQRLHSYHRLSRWLQKEDYFDLSQGKVEWNSFCEQLKRRLSKAGQERD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 769-926 constitute the expression domain of recombinant Mouse Tlr11. This Tlr11 protein is expected to have a theoretical molecular weight of 25.7 kDa. The Tlr11 protein was expressed in e.coli. The Tlr11 gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Tlr11 protein during the following stages.
The mouse Toll-like receptor 11 (Tlr11) is a member of the Toll-like receptor (TLR) family, a group of pattern recognition receptors that play a crucial role in the innate immune system. TLRs recognize conserved molecular patterns on pathogens, activating immune responses. Tlr11 is unique to rodents, and its function is particularly important in recognizing uropathogenic bacteria. Upon ligand binding, Tlr11 activates signaling pathways leading to the production of pro-inflammatory cytokines and type I interferons, contributing to the host defense against bacterial infections. Understanding the role of Tlr11 in the immune response provides insights into the mechanisms of pathogen recognition and may have implications for developing strategies to modulate immune responses in infectious diseases.
