Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial

In Stock
Code CSB-BP723744MO
Abbreviation Recombinant Mouse Tpp2 protein, partial
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Tpp2
Uniprot No.
Research Area
Others
Alternative Names
Tpp2; Tripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
44-264aa
Target Protein Sequence
DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2) is produced using a baculovirus expression system and includes amino acids 44 to 264. This partial protein carries an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the protein purity exceeds 85%, indicating it should work well as a research reagent.

Tripeptidyl-peptidase 2 (Tpp2) appears to be a key protease that breaks down oligopeptides inside cells. The protein likely plays an important role in protein turnover and seems to be involved in various cellular processes, including immune response regulation. As part of the proteasome-associated complex, Tpp2 may be crucial for maintaining cellular protein balance, which makes it particularly interesting for researchers studying cell biology and immunology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Tpp2 is a serine peptidase that requires precise folding, proper active site formation, and specific tertiary structure for its enzymatic activity. The baculovirus expression system provides a eukaryotic environment that supports proper folding, disulfide bond formation, and potential post-translational modifications. However, the partial fragment (44-264aa) may lack critical domains necessary for full enzymatic activity, such as the complete catalytic site or oligomerization interfaces. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may cause some steric interference but are unlikely to completely disrupt folding in this system. The probability of correct folding is high due to the expression system, but functional peptidase activity requires experimental validation since the fragment is incomplete.

1. Protein-Protein Interaction Studies

This application carries significant risk without domain validation. Tpp2 interactions often require full-length protein or specific domains not present in this fragment. If the fragment contains relevant interaction domains and is correctly folded (verified through structural assays), it may identify physiological partners. If misfolded or lacking domains, there is high risk of non-specific binding or tag-mediated artefacts.

2. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional folding. The fragment provides defined epitopes within the 44-264aa region for generating Tpp2-specific antibodies. The dual tags offer built-in controls for immunization and screening. However, antibodies may not recognize conformational epitopes of full-length Tpp2.

3. Structural and Biochemical Characterization

These studies are suitable for basic characterization of the fragment. Techniques like circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation can assess folding, stability, and oligomeric state. However, results will not reflect full-length Tpp2 properties, and enzymatic activity cannot be assumed due to the partial nature.

4. Tag-Based Detection Assays

This application is highly suitable as it relies solely on tag detection. The dual His and Myc tags enable technical applications like sandwich ELISA, protein quantification, and purification optimization without requiring functional Tpp2 activity.

Final Recommendation & Action Plan

The baculovirus-expressed Tpp2 fragment with dual tags has a high probability of correct folding due to the eukaryotic expression system, but its functional utility is limited by the partial length. Begin with Application 3 (Structural Characterization) to validate folding quality through techniques like CD spectroscopy and SEC. Applications 2 and 4 (antibody development and tag-based assays) can proceed immediately. Application 1 (protein-protein interaction studies) requires prior validation that the fragment contains relevant interaction domains and is properly folded. For reliable Tpp2 functional studies, including enzymatic activity, use full-length protein expressed in a suitable system.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Stimulates adipogenesis.
Gene References into Functions
  1. Data indicate that TPPII can regulate sperm maturation by modulating intracellular Ca(2+) stores via the type 3 RyR. PMID: 23818952
  2. Previously unknown differences between TPP II orthologues and subtilisin as well as features that might be conserved within the entire family of subtilisin-like serine peptidases. PMID: 22266401
  3. Tripeptidyl peptidase II is crucial for nucleoprotein epitope generation during major histocompatibility complex class I complex viral antigen processing both in the presence and absence of lactacystin-sensitive proteasome action. PMID: 17088258
  4. TPPII is not generally required for the production of major histocompatibility class I-restricted peptides, but presentation of some peptides can be negatively affected by TPPII. PMID: 17357105
  5. Data show that mice that were homozygous for an insertion in the Tpp2 locus were embryonic lethal and Tpp2 heterozygous mutants were lean compared with wild-type littermates, although food intake was normal. PMID: 17932511
  6. The data suggest a moderate, predominantly destructive role of TPPII in class I Ag processing. PMID: 18056356
  7. TPPII is important for maintaining normal cellular and systemic physiology, which may be relevant for potential therapeutic applications of TPPII inhibitors PMID: 18362329
  8. These results do not support a generally important role of TPPII for viability and proliferation of transformed cells or their p53-mediated DNA damage response. PMID: 19539606
  9. These data indicate that while TPPII contributes to the trimming of peptides with very long N-terminal extensions, TPPII is not essential for generating most MHC class I-presented peptides or for stimulating CTL responses to several Ags in vivo. PMID: 19841172

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=Translocates to the nucleus in responce to gamma-irradiation.
Protein Families
Peptidase S8 family
Tissue Specificity
Expressed in the brain, skeletal muscle, gonadal and mesenteric white adipose tissue and brown adipose tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*