Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial

In Stock
Code CSB-BP723744MO
Abbreviation Recombinant Mouse Tpp2 protein, partial
MSDS
Size $528
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Tpp2
Uniprot No.
Research Area
Others
Alternative Names
Tpp2; Tripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
44-264aa
Target Protein Sequence
DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2) is produced using a baculovirus expression system and includes amino acids 44 to 264. This partial protein carries an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the protein purity exceeds 85%, indicating it should work well as a research reagent.

Tripeptidyl-peptidase 2 (Tpp2) appears to be a key protease that breaks down oligopeptides inside cells. The protein likely plays an important role in protein turnover and seems to be involved in various cellular processes, including immune response regulation. As part of the proteasome-associated complex, Tpp2 may be crucial for maintaining cellular protein balance, which makes it particularly interesting for researchers studying cell biology and immunology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies

This dual-tagged mouse Tpp2 fragment (amino acids 44-264) could work in pull-down experiments to find potential binding partners or other interacting proteins. The N-terminal His-tag allows researchers to attach it to nickel-affinity resins, and the C-terminal Myc-tag helps detect and confirm the bait protein when studying complex formation. This partial construct might still contain important interaction domains that could be mapped by testing it against cellular lysates or purified protein collections.

2. Antibody Development and Validation

Researchers could use the recombinant Tpp2 fragment as an immunogen or screening antigen when developing antibodies specific to mouse Tpp2. The dual tagging system creates built-in positive controls for immunoassays - anti-His or anti-Myc antibodies can check protein integrity and loading. This partial construct may display epitopes that antibodies can access easily while avoiding potential problems with full-length protein folding or stability issues.

3. Structural and Biochemical Characterization

The specific 44-264aa region of mouse Tpp2 is suitable for analysis using biophysical methods like circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation to study its folding properties and how it forms complexes with itself. The high purity (over 85%) and dual tags make protein quantification and handling easier for structural work. This fragment might represent a stable domain or functional unit that could reveal details about how the complete enzyme is organized.

4. Tag-Based Detection Assays

The combination of His and Myc tags opens up possibilities for creating sandwich-type detection assays or ELISA-based methods for research purposes. Anti-His antibodies could capture the protein while anti-Myc antibodies handle detection, or researchers could switch these roles depending on what works better for their specific setup. This strategy might prove useful for tracking protein stability, developing purification methods, or creating quantitative approaches for other Tpp2-related studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Stimulates adipogenesis.
Gene References into Functions
  1. Data indicate that TPPII can regulate sperm maturation by modulating intracellular Ca(2+) stores via the type 3 RyR. PMID: 23818952
  2. Previously unknown differences between TPP II orthologues and subtilisin as well as features that might be conserved within the entire family of subtilisin-like serine peptidases. PMID: 22266401
  3. Tripeptidyl peptidase II is crucial for nucleoprotein epitope generation during major histocompatibility complex class I complex viral antigen processing both in the presence and absence of lactacystin-sensitive proteasome action. PMID: 17088258
  4. TPPII is not generally required for the production of major histocompatibility class I-restricted peptides, but presentation of some peptides can be negatively affected by TPPII. PMID: 17357105
  5. Data show that mice that were homozygous for an insertion in the Tpp2 locus were embryonic lethal and Tpp2 heterozygous mutants were lean compared with wild-type littermates, although food intake was normal. PMID: 17932511
  6. The data suggest a moderate, predominantly destructive role of TPPII in class I Ag processing. PMID: 18056356
  7. TPPII is important for maintaining normal cellular and systemic physiology, which may be relevant for potential therapeutic applications of TPPII inhibitors PMID: 18362329
  8. These results do not support a generally important role of TPPII for viability and proliferation of transformed cells or their p53-mediated DNA damage response. PMID: 19539606
  9. These data indicate that while TPPII contributes to the trimming of peptides with very long N-terminal extensions, TPPII is not essential for generating most MHC class I-presented peptides or for stimulating CTL responses to several Ags in vivo. PMID: 19841172

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=Translocates to the nucleus in responce to gamma-irradiation.
Protein Families
Peptidase S8 family
Tissue Specificity
Expressed in the brain, skeletal muscle, gonadal and mesenteric white adipose tissue and brown adipose tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*