Recombinant Mouse Tripeptidyl-peptidase 2 (Tpp2), partial

Code CSB-MP723744MO
Abbreviation Recombinant Mouse Tpp2 protein, partial
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Tpp2
Uniprot No.
Research Area
Others
Alternative Names
Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II)
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
44-264aa
Target Protein Sequence
DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
18-28 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Stimulates adipogenesis.
Gene References into Functions
  1. Data indicate that TPPII can regulate sperm maturation by modulating intracellular Ca(2+) stores via the type 3 RyR. PMID: 23818952
  2. Previously unknown differences between TPP II orthologues and subtilisin as well as features that might be conserved within the entire family of subtilisin-like serine peptidases. PMID: 22266401
  3. Tripeptidyl peptidase II is crucial for nucleoprotein epitope generation during major histocompatibility complex class I complex viral antigen processing both in the presence and absence of lactacystin-sensitive proteasome action. PMID: 17088258
  4. TPPII is not generally required for the production of major histocompatibility class I-restricted peptides, but presentation of some peptides can be negatively affected by TPPII. PMID: 17357105
  5. Data show that mice that were homozygous for an insertion in the Tpp2 locus were embryonic lethal and Tpp2 heterozygous mutants were lean compared with wild-type littermates, although food intake was normal. PMID: 17932511
  6. The data suggest a moderate, predominantly destructive role of TPPII in class I Ag processing. PMID: 18056356
  7. TPPII is important for maintaining normal cellular and systemic physiology, which may be relevant for potential therapeutic applications of TPPII inhibitors PMID: 18362329
  8. These results do not support a generally important role of TPPII for viability and proliferation of transformed cells or their p53-mediated DNA damage response. PMID: 19539606
  9. These data indicate that while TPPII contributes to the trimming of peptides with very long N-terminal extensions, TPPII is not essential for generating most MHC class I-presented peptides or for stimulating CTL responses to several Ags in vivo. PMID: 19841172

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=Translocates to the nucleus in responce to gamma-irradiation.
Protein Families
Peptidase S8 family
Tissue Specificity
Expressed in the brain, skeletal muscle, gonadal and mesenteric white adipose tissue and brown adipose tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*