Recombinant Mouse-ear cress 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)

In Stock
Code CSB-YP822134DOA
Abbreviation Recombinant Mouse-ear cress BAS1 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
BAS1
Uniprot No.
Research Area
Others
Alternative Names
2-Cys peroxiredoxin A; 2-Cys peroxiredoxin BAS1; 2-Cys Prx A; BAS1; BAS1A_ARATH; chloroplastic; Thiol-specific antioxidant protein A
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
Yeast
Expression Region
66-266aa
Target Protein Sequence
KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Arabidopsis thaliana 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1) is produced in a yeast expression system, covering the mature protein from amino acids 66 to 266. The protein is expressed with an N-terminal 6xHis-tag to aid in purification and detection. Purity exceeds 90% as verified by SDS-PAGE, which appears to ensure reliable results for research applications.

2-Cys peroxiredoxin BAS1 plays a critical role in redox regulation within chloroplasts of Arabidopsis thaliana. It's involved in detoxifying peroxides and maintaining cellular redox homeostasis. This protein serves as a valuable tool for studying oxidative stress responses and redox signaling pathways in plants. It may provide insights into plant physiology and stress tolerance mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis-tag on this recombinant BAS1 protein allows for nickel-affinity based pull-down experiments to identify potential interaction partners from Arabidopsis chloroplast extracts. Being a chloroplastic 2-Cys peroxiredoxin, BAS1 likely participates in redox regulation networks within the chloroplast. This makes it valuable for mapping these protein interaction networks, though results will depend on experimental conditions. The >90% purity should minimize background binding from contaminant proteins during pull-down experiments. This approach could help clarify the molecular mechanisms of chloroplast redox homeostasis in plant cells.

2. Antibody Development and Validation

The high purity (>90%) and defined expression region (66-266aa) make this recombinant protein suitable as an immunogen for generating specific antibodies against Arabidopsis BAS1. The recombinant protein can serve as both positive control and standard for antibody specificity testing through Western blot, ELISA, and immunoprecipitation assays. Its His-tag makes purification and immobilization straightforward for antibody screening and validation experiments. These antibodies would likely become valuable research tools for studying BAS1 expression and localization in plant tissues.

3. Biochemical Characterization and Enzyme Kinetics Analysis

This recombinant BAS1 protein can be used for detailed biochemical characterization studies. These include thermal stability analysis, pH optimization, and cofactor requirements typical of 2-Cys peroxiredoxins. The high purity level allows for reliable spectrophotometric and fluorometric assays to determine basic biochemical properties, though some variation between batches may still occur. Researchers can investigate the protein's response to various reducing agents and oxidative conditions to understand its redox behavior. The defined expression region should ensure relatively consistent results across different experimental batches.

4. Comparative Structural and Functional Studies

The recombinant BAS1 protein enables comparative studies with other plant peroxiredoxins or homologous proteins from different species. This may help researchers understand evolutionary relationships and functional conservation within this protein family. The yeast expression system and high purity should make experiments reproducible when comparing enzymatic properties, stability, and molecular interactions. Researchers can use this protein alongside other recombinant peroxiredoxins to study structure-function relationships. The His-tag allows for standardized purification protocols across different protein variants, which is important for fair comparison.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf.
Gene References into Functions
  1. These quantitative data support a model where 2-CysPrx and Cyp20-3, by interaction, form a redox-sensitive regulatory module in the chloroplast which is under control of the photosynthesis-linked stromal pH value, the redox state and additional stromal protein factor(s).[2-CysPrx] PMID: 26872837
  2. Substitution of Cys for Ser at amino acid location 150 of the alpha-helix of 2-Cys Prx A regulates/enhances the dual peroxidase and chaperone enzymatic functions. [2-cysteine peroxiredoxin A] PMID: 26141131
  3. BAS1 and SOB7 act redundantly with respect to light promotion of cotyledon expansion, repression of hypocotyl elongation and flowering time in addition to other phenotypes not regulated by light. PMID: 15773851
Subcellular Location
Plastid, chloroplast.
Protein Families
Peroxiredoxin family, AhpC/Prx1 subfamily
Database Links

KEGG: ath:AT3G11630

STRING: 3702.AT3G11630.1

UniGene: At.22950

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*