Recombinant Arabidopsis thaliana 2-Cys peroxiredoxin BAS1, chloroplastic(BAS1)

Code CSB-YP822134DOAb1
Product Type Recombinant Protein
Size US$2959
Uniprot No. Q96291
Relevance May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Thiol-specific antioxidant protein A
Species Arabidopsis thaliana (Mouse-ear cress)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
Research Area Others
Source Yeast
Gene Names BAS1
Protein Names Thiol-specific antioxidant protein A
Expression Region 66-266aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 26.4 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf.
Subcellular Location Plastid, chloroplast
Protein Families Peroxiredoxin family, AhpC/Prx1 subfamily
Database Links

KEGG: ath:AT3G11630

STRING: 3702.AT3G11630.1

UniGene: At.22950

Related Products

BAS1 Antibodies

BAS1 Antibodies for Arabidopsis thaliana

BAS1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

BAS1 Proteins

BAS1 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.