Home
Protein
Recombinant Proteins
Recombinant Mycoplasma pneumoniae Mgp-operon protein 3 (MPN_142), partial

Recombinant Mycoplasma pneumoniae Mgp-operon protein 3 (MPN_142), partial

^{In Stock}

Code	CSB-EP687358MLW
Abbreviation	Recombinant Mycoplasma pneumoniae Mgp-operon protein 3, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

MPN_142

Uniprot No.

Q50341

Research Area

Others

Alternative Names

MPN_142; MP012Mgp-operon protein 3; Mgp3; ORF-3 protein

Species

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Source

E.coli

Expression Region

487-718aa

Target Protein Sequence

IVVMGSDRVPSLWYWVVGEDQESGKATWWAKTELNWGTDKQKQFVENQLGFKDDSNSDSKNSNLKAQGLTQPAYLIAGLDVVADHLVFAAFKAGAVGYDMTTDSSASTYNQALAWSTTAGLDSDGGYKALVENTAGLNGPINGLFTLLDTFAYVTPVSGMKGGSQNNEEVQTTYPVKSDQKATAKIASLINASPLNSYGDDGVTVFDALGLNFNFKLNEERLPSRTDQLLVY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.5 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In the production of the recombinant Mycoplasma pneumoniae (strain ATCC 29342 / M129) MPN_142 protein in e.coli cells, a sequential pipeline involves constructing the expression vector coding for the Mycoplasma pneumoniae (strain ATCC 29342 / M129) MPN_142 protein (487-718aa), transforming the recombinant vector into e.coli cells, selecting the positive cells and cultivating them, lysing cells, and characterizing the protein. The resulting recombinant Mycoplasma pneumoniae (strain ATCC 29342 / M129) MPN_142 protein is purified from the cell lysate using affinity purification. Its purity exceeds 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions

subtype-specific combinations of the repetitive elements in the P1 and ORF6 genes are not essential for the successful adherence of M. pneumoniae to host cells and the colonization of the respiratory tract of guinea pigs. PMID: 15583152
Analysis of MPN142 in a cytadhering revertant and complementation using a recombinant wild-type allele confirmed the role of this mutation in the cytadherence defect. PMID: 15629945

Subcellular Location

Cell membrane; Single-pass membrane protein.

Database Links

KEGG: mpn:MPN142

Promotions