Recombinant Mycoplasma pneumoniae Putative Xaa-Pro aminopeptidase(pepP)

Code CSB-EP303407MLW
Product Type Recombinant Protein
Size US$2466
Uniprot No. P75313
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP303407MLW could indicate that this peptide derived from E.coli-expressed Mycoplasma pneumoniae (strain ATCC 29342 / M129) pepP.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP303407MLW could indicate that this peptide derived from E.coli-expressed Mycoplasma pneumoniae (strain ATCC 29342 / M129) pepP.
Storage Buffer Tris-based buffer,50% glycerol
Alias Short name: X-Pro aminopeptidase Alternative name(s): Aminoacylproline aminopeptidase Aminopeptidase P Short name: APP
Species Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MHNELQQKLAVLHKLLQDNKADAILIGSDQNRFWLTGFPSSAGWLVVHKQRVNLFIDGRYFEAAKTAIDPLVKVELFTTYKQVKALCEQVGVKHLLIEGDYLTFNYQNFIKELCAQYTVINAQEIRRQKLPSEILAIEKVVEITRKVAVKLKRFIQPGMTELFIAQWITDQLVKAGGAKNSFDPIVATGKNGANPHHKPSKLKVKSGDFVTCDFGTIYNGYCSDITRTFLVGKKPNNEVLLKAYKKVDEANMAGINAANTQLTGAEVDKVCRDIIEASEFKDYFVHSTGHGVGLDIHEMPNVSTSYNKLLCENAVITIEPGIYIPSVGGIRIEDMVLVKDHKSVWLSAKIPRAF
Research Area Microbiology
Source E.coli
Gene Names pepP
Protein Names Recommended name: Putative Xaa-Pro aminopeptidase Short name= X-Pro aminopeptidase EC= 3.4.11.9 Alternative name(s): Aminoacylproline aminopeptidase Aminopeptidase P Short name= APP
Expression Region 1-354aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 55.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

pepP Antibodies

pepP Antibodies for Mycoplasma pneumoniae

pepP Proteins

pepP Proteins for Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.