Recombinant Neosartorya fumigata Vacuolar protease A(pep2)


In Stock
Code CSB-EP523645NGS
Product Type Recombinant Protein
Size US$2466
Uniprot No. O42630
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SRHDVLVDNFLNAQYFSEISLGTPPQKFKVVLDTGSSNLWVPGSDCSSIACFLHNKYDSSASSTYKANGTEFAIKYGSGELSGFVSQDTLQIGDLKVVKQDFAEATNEPGLAFAFGRFDGILGLGYDTISVNKIVPPFYNMLDQGLLDEPVFAFYLGDTNKEGDNSEASFGGVDKNHYTGELTKIPLRRKAYWEVDFDAIALGDNVAELENTGIILDTGTSLIALPSTLADLLNKEIGAKKGFTGQYSIECDKRDSLPDLTFTLAGHNFTIGPYDYTLEVQGSCISSFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNNAVGLAKAK
Research Area Others
Source E.coli
Gene Names pep2
Protein Names Recommended name: Vacuolar protease A EC= 3.4.23.25 Alternative name(s): Aspartic endopeptidase pep2 Aspartic protease pep2
Expression Region 71-398aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 39.7 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Vacuolar aspartic endopeptidase which is probably also secreted and contributes to virulence.
Subcellular Location Vacuole lumen, Secreted
Protein Families Peptidase A1 family
Database Links

KEGG: afm:AFUA_3G11400

STRING: 5085.CADAFUBP00003699

Related Products

pep2 Antibodies

pep2 Antibodies for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

pep2 Proteins

pep2 Proteins for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.