Home
Protein
Recombinant Protein
Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial

Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial

^{In Stock}

Code	CSB-EP761ABS
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP076174Ba could indicate that this peptide derived from E.coli-expressed Acinetobacter baumannii ndm-1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP076174Ba could indicate that this peptide derived from E.coli-expressed Acinetobacter baumannii ndm-1.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NDM-1

Uniprot No.

F8UNN7

Species

Acinetobacter baumannii

Source

E.coli

Expression Region

164-222aa

Target Protein Sequence

AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

22.0kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The DNA coding sequence translated into the Acinetobacter baumannii NDM-1 protein sequence (164-222aa) was fused with the N-terminal 6xHis-SUMO tag sequence to form the recombinant DNA, which was inserted into an expression vector. The reconstructed expression vector was transformed into the E.coli for follow-up expression. The product underwent purification to obtain the recombinant Acinetobacter baumannii NDM-1 protein with N-terminal 6xHis-SUMO tag. The SDS-PAGE analysis determined its purity higher than 90%. After electrophoresis, a 21 kDa protein band was observed on the gel.

NDM-1 is a gene providing instructions for making a protein Beta-lactamase in Acinetobacter baumannii. This gene is a novel metallo-beta-lactamase (MBL) gene carried by some Enterobacteriaceae that induces resistance to most of the antibiotics. This gene was first describled in a Swedish patient hospitalized in India with an infection due to Klebsiella pneumoniae. NDM-1 makes bacteria resistant to a broad range of beta-lactam antibiotics, including the antibiotics of the carbapenem family (a mainstay for the treatment of antibiotic-resistant bacterial infections).