Recombinant Oryza sativa subsp. japonica Protein YABBY 2(YAB2)

Product Type Recombinant Protein
Uniprot No. Q10FZ7
Abbreviation YAB2
Species Oryza sativa subsp. japonica (Rice)
Gene Names YAB2
Protein Names Recommended name: Protein YABBY 2 Alternative name(s): OsYABBY2 Short name= OsYAB2 Protein FILAMENTOUS FLOWER 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Subcellular Location Nucleus
Protein Families YABBY family
Tissue Specificity Expressed in leaf blades, leaf sheaths and flowers.
Database Links

KEGG: osa:4333584

STRING: 39947.LOC_Os03g44710.1

UniGene: Os.16937

Product Details for Different Expression Systems

Product Name Recombinant Oryza sativa subsp. japonica Protein YABBY 2(YAB2),Yeast
Code CSB-YP604664OFG
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAQIVPAPEHVCYVHCNFCNTIFAVSVPSNSMLNIVTVRCGHCTSLLSVNLRGLVQALP AEDHLQDNLKMHNMSFRENYSEYGSSSRYGRVPMMFSKNDTEHMLHVRPPEKRQRVPSAY NRFIKEEIRRIKANNPDISHREAFSTAAKNWAHFPNIHFGLGSHESSKKLDEAIGAPSPQ KVQRLY
Expression Region 1-186
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Oryza sativa subsp. japonica Protein YABBY 2(YAB2),E.coli
Code CSB-EP604664OFG
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAQIVPAPEHVCYVHCNFCNTIFAVSVPSNSMLNIVTVRCGHCTSLLSVNLRGLVQALP AEDHLQDNLKMHNMSFRENYSEYGSSSRYGRVPMMFSKNDTEHMLHVRPPEKRQRVPSAY NRFIKEEIRRIKANNPDISHREAFSTAAKNWAHFPNIHFGLGSHESSKKLDEAIGAPSPQ KVQRLY
Expression Region 1-186
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Oryza sativa subsp. japonica Protein YABBY 2(YAB2),Baculovirus
Code CSB-BP604664OFG
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAQIVPAPEHVCYVHCNFCNTIFAVSVPSNSMLNIVTVRCGHCTSLLSVNLRGLVQALP AEDHLQDNLKMHNMSFRENYSEYGSSSRYGRVPMMFSKNDTEHMLHVRPPEKRQRVPSAY NRFIKEEIRRIKANNPDISHREAFSTAAKNWAHFPNIHFGLGSHESSKKLDEAIGAPSPQ KVQRLY
Expression Region 1-186
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Oryza sativa subsp. japonica Protein YABBY 2(YAB2),Mammalian cell
Code CSB-MP604664OFG
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSAQIVPAPEHVCYVHCNFCNTIFAVSVPSNSMLNIVTVRCGHCTSLLSVNLRGLVQALP AEDHLQDNLKMHNMSFRENYSEYGSSSRYGRVPMMFSKNDTEHMLHVRPPEKRQRVPSAY NRFIKEEIRRIKANNPDISHREAFSTAAKNWAHFPNIHFGLGSHESSKKLDEAIGAPSPQ KVQRLY
Expression Region 1-186
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

YAB2 Antibodies

YAB2 Antibodies for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.