Code | CSB-YP327084EQJ |
Abbreviation | Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase protein, partial |
MSDS | |
Size | $436 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
May I request the CofA for CSB-YP327084EQJ (Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase, partial)?
Please confirm whether or not this preparation has been tested for enzyme activity, and if so, what is the specific activity of the current selling lot, and what is the definition of one unit of activity?
VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN