Home
Protein
Recombinant Protein
Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase, partial

Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase, partial

^{In Stock}

Code	CSB-YP327084EQJ
MSDS	MSDS
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Uniprot No.

P31835

Research Area

Microbiology

Alternative Names

; Cyclomaltodextrin glucanotransferase; EC 2.4.1.19; Cyclodextrin-glycosyltransferase; CGTase

Species

Paenibacillus macerans (Bacillus macerans)

Source

Yeast

Expression Region

608-713aa

Target Protein Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

13.4kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

May I request the CofA for CSB-YP327084EQJ (Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase, partial)?
Please confirm whether or not this preparation has been tested for enzyme activity, and if so, what is the specific activity of the current selling lot, and what is the definition of one unit of activity?

Very nice to receive your inquiry. This is a in-stock protein which can be shipped out immediately. The product details are confirmed as below.
Code: CSB-YP327084EQJ
Name: Recombinant Paenibacillus macerans Cyclomaltodextrin glucanotransferase,partial
Expression Region: 608-713aa; Partial
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Delivery Form: Liquid
Storage Buffer: 0.2 μm sterile filtered 20 mM Tris-HCl,0.5M NaCl,pH 8.0, 20% glycerol
Endotoxin Removal: Yes
Aseptic Processing: Yes
Enzyme Activity: We haven't tested the activity of this protein yet so we can't 100% guarantee that it has activity. The protein we provide is CBM20 domain which is purified under mild conditions.