Recombinant Phleum pratense Pollen allergen Phl p 5b

In Stock
Code CSB-EP671435EUQ
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q40963
Relevance Has ribonuclease activity. May be involved in host-pathogen interactions.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP671435EUQ could indicate that this peptide derived from E.coli-expressed Phleum pratense (Common timothy) Phl p 5b.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP671435EUQ could indicate that this peptide derived from E.coli-expressed Phleum pratense (Common timothy) Phl p 5b.
Storage Buffer Tris-based buffer,50% glycerol
Alias Allergen Phl p VbAllergen: Phl p 5b
Species Phleum pratense (Common timothy)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
Research Area Others
Source E.coli
Expression Region 20-284aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 42.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has ribonuclease activity. May be involved in host-pathogen interactions.
Protein Families Poa p IX/Phl p VI allergen family

Related Products

Antibodies

Antibodies for Phleum pratense

Proteins

Proteins for Phleum pratense (Common timothy)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.