Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP671435EUQ |
| Product Type | Recombinant Protein |
| Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | Q40963 |
| Relevance | Has ribonuclease activity. May be involved in host-pathogen interactions. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Allergen Phl p VbAllergen: Phl p 5b |
| Species | Phleum pratense (Common timothy) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV |
| Research Area | Others |
| Source | E.coli |
| Expression Region | 20-284aa |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Mol. Weight | 42.1kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Has ribonuclease activity. May be involved in host-pathogen interactions. |
| Protein Families | Poa p IX/Phl p VI allergen family |
Antibodies for Phleum pratense
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA671435HA01EUQ | Pollen allergen Phl p 5b Antibody | Phleum pRatense | ELISA, WB |
| CSB-PA671435HB01EUQ | Pollen allergen Phl p 5b Antibody, HRP conjugated | Phleum pratense | ELISA |
| CSB-PA671435HD01EUQ | Pollen allergen Phl p 5b Antibody, Biotin conjugated | Phleum pratense | ELISA |
| CSB-PA671435HC01EUQ | Pollen allergen Phl p 5b Antibody, FITC conjugated | Phleum pratense | ELISA |
Proteins for Phleum pratense (Common timothy)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP671435EUQ CSB-BP671435EUQ CSB-MP671435EUQ |
Recombinant Phleum pratense Pollen allergen Phl p 5b | Yeast Baculovirus Mammalian cell |
Recombinant Human Lysine-specific demethylase 5A(KDM5A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein Rab-11A(RAB11A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5(LILRA5),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Muscle, skeletal receptor tyrosine-protein kinase(MUSK),partial
Express system: Yeast
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
