Recombinant Pig Saposin-B-Val(PSAP)

Code CSB-YP018836PI
Product Type Recombinant Protein
Size US$2959
Uniprot No. P81405
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018836PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018836PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP.
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV
Research Area Metabolism
Source Yeast
Gene Names PSAP
Protein Names Recommended name: Saposin-B-Val Cleaved into the following chain: 1. Saposin-B Alternative name(s): Cerebroside sulfate activator Short name= CS-ACT Non-specific activator Sphingolipid activator protein 1 Short name= SAP-
Expression Region 1-80aa
Tag Info N-terminal 6xHis-Flag-tagged
Mol. Weight 11.9 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.
Database Links

UniGene: Ssc.54000

Related Products

PSAP Proteins

PSAP Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.