Recombinant Pig Saposin-B-Val (PSAP)

In Stock
Code CSB-YP018836PI
Abbreviation Recombinant Pig PSAP protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018836PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP018836PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) PSAP.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PSAP
Uniprot No.
Research Area
Metabolism
Alternative Names
PSAPSaposin-B-Val [Cleaved into: Saposin-B; Cerebroside sulfate activator; CS-ACT; Non-specific activator; Sphingolipid activator protein 1; SAP-1)]
Species
Sus scrofa (Pig)
Source
Yeast
Expression Region
1-80aa
Target Protein Sequence
GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-Flag-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pig Saposin-B-Val (PSAP) is expressed in a yeast system, yielding a full-length protein with 80 amino acids. The protein carries an N-terminal 6xHis-Flag tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the product achieves greater than 90% purity, suggesting it meets high-quality standards for research work. This product is meant for research use only and should not be used for clinical or diagnostic purposes.

Saposin-B-Val appears to play a crucial role in breaking down sphingolipids—lipids that are involved in cell membrane structure and signaling pathways. It works as an activator for certain lysosomal enzymes, helping these enzymes break down lipids more effectively. Studying Saposin-B-Val may be important for understanding lysosomal storage disorders and how sphingolipid metabolism affects broader cellular processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant pig PSAP is produced in a yeast expression system as a full-length protein (1-80aa) with an N-terminal 6xHis-Flag tag. PSAP is a small, disulfide-rich protein involved in sphingolipid metabolism, and its bioactivity depends on precise folding and disulfide bond formation. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and some post-translational modifications, which increases the probability of correct folding for this small protein. However, the dual His-Flag tag at the N-terminus is relatively large and may sterically interfere with native folding or function, as the N-terminal region could be critical for PSAP's activity. No validation data (e.g., lipid binding assays, circular dichroism) are provided. Therefore, while yeast expression offers advantages, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. Protein-Protein Interaction Studies

If the recombinant PSAP is correctly folded, the dual His-Flag tag allows for pull-down assays to identify binding partners, such as lipids or other proteins involved in sphingolipid metabolism. However, if misfolded, interaction domains may be altered, leading to non-specific binding or failure to recognize genuine biological partners, compromising the validity of results. The large tag may also sterically hinder some interactions even if the protein is properly folded.

2. Comparative Structural and Functional Analysis

If properly folded, the recombinant PSAP can be used for comparative biophysical analyses (e.g., circular dichroism, dynamic light scattering) to study structural differences across species. However, if misfolded, structural data would misrepresent the native protein's architecture, and any cross-species comparisons would be biologically irrelevant. The tag should be removed for high-resolution structural studies to avoid interference.

3. Antibody Development and Validation

This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The high purity and full-length sequence support consistent immunization and screening. However, if correctly folded, antibodies may recognize conformational epitopes relevant to native PSAP; if misfolded, generated antibodies might not optimally bind the full-length protein in biological contexts.

4. In Vitro Biochemical Assay Development

If correctly folded and functional, the recombinant protein can be used to develop biochemical assays for studying stability, pH sensitivity, or lipid binding. However, if misfolded, assay results would be unreliable, and any optimization based on such data could lead to inaccurate protocols. The tag may affect protein behavior in assays, so validation is critical.

Final Recommendation & Action Plan

Before using this recombinant PSAP in functional applications, validate its folding and bioactivity through biophysical methods (e.g., circular dichroism for secondary structure, disulfide bond analysis) and functional assays (e.g., lipid binding tests); if validation confirms proper folding, proceed with applications while considering the potential tag interference—especially for interaction and structural studies where tag removal may be beneficial; if misfolded, consider using tag-free protein or alternative expression systems; for immediate use, antibody development can proceed but validate antibodies against native PSAP; avoid functional studies until folding and bioactivity are confirmed. Always include appropriate controls, such as known PSAP standards or lipid binding positives, to ensure reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.
Database Links

UniGene: Ssc.54000

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*