Recombinant Pig Transcobalamin-1(TCN1)

Code CSB-YP023317PI
Product Type Recombinant Protein
Size US$2959
Uniprot No. P17630
Relevance Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP023317PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) TCN1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP023317PI could indicate that this peptide derived from Yeast-expressed Sus scrofa (Pig) TCN1.
Storage Buffer Tris-based buffer,50% glycerol
Alias CobalophilinHaptocorrin;Protein RTranscobalamin I ;TC I ;TCI
Species Sus scrofa (Pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI
Research Area Others
Source Yeast
Gene Names TCN1
Protein Names Recommended name: Transcobalamin-1 Short name= TC-1 Alternative name(s): Cobalophilin Haptocorrin Protein R Transcobalamin I Short name= TC I Short name= TCI
Expression Region 25-416aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 46.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (By similarity). Binds to cobalamin and to cobalamin analogs such as cobinamide.
Subcellular Location Secreted
Protein Families Eukaryotic cobalamin transport proteins family
Tissue Specificity Haptocorrins are a family of cobalamin-binding glycoproteins found in blood, salivary and mucosal secretions.
Database Links

UniGene: Ssc.16234

Related Products

TCN1 Proteins

TCN1 Proteins for Sus scrofa (Pig)

TCN1 ELISA Kit

TCN1 ELISA Kit for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.