Recombinant Pig Uricase (UOX)

In Stock
Code CSB-EP025648PI
Abbreviation Recombinant Pig UOX protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
UOX
Uniprot No.
Research Area
Others
Alternative Names
UOX; Uricase; EC 1.7.3.3; Urate oxidase
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
1-304aa
Target Protein Sequence
MAHYRNDYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDVIPTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRFEKNGVKHVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLYDIQVLTLGQVPEIEDMEISLPNIHYLNIDMSKMGLINKEEVLLPLDNPYGRITGTVKRKLTSRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.0kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pig Uricase (UOX) is expressed in E. coli and consists of the full-length protein spanning amino acids 1 to 304. The protein features an N-terminal 6xHis-SUMO tag, which appears to improve both solubility and purification efficiency. SDS-PAGE analysis confirms a purity level greater than 90%. This protein is designed strictly for research use, maintaining what seems to be solid quality standards for experimental work.

Uricase, or urate oxidase as it's sometimes called, plays a critical role in oxidizing uric acid to allantoin—a key step in purine metabolism. Researchers often find this enzyme valuable when studying uric acid metabolism and related disorders. The conversion of uric acid to a more soluble form may be essential for understanding degradation pathways and potential therapeutic approaches.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant pig uricase is expressed in E. coli, a prokaryotic system that is generally suitable for producing soluble enzymatic proteins like uricase. Uricase is a relatively well-behaved enzyme that typically forms a homotetramer and does not require complex post-translational modifications for activity. The presence of an N-terminal 6xHis-SUMO tag may enhance solubility and proper folding, with the SUMO tag particularly known to improve folding efficiency. The protein is full-length (1-304aa) with high purity (>90%), which are positive indicators. However, since enzymatic activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its uricase activity. The tetramerization capability, which is essential for function, also requires confirmation.

1. Protein-Protein Interaction Studies Using His-Tag Affinity Purification

The N-terminal 6xHis-SUMO tag enables technical feasibility for pull-down assays. However, if the uricase is improperly folded or fails to tetramerize correctly, identified interactions may not be physiologically relevant. This application should be pursued only after confirming proper folding and tetramerization through biochemical characterization.

2. Comparative Biochemical Analysis Across Species

This application is appropriate for structural and biophysical comparisons. The full-length uricase allows for meaningful comparison of stability, thermal denaturation, and other physical properties across species. However, functional comparisons (e.g., specific activity) require prior validation of this uricase's enzymatic activity.

3. Antibody Development and Validation

This application is well-suited as the primary use case. The high purity and full-length sequence make it an excellent immunogen for antibody production. Even if misfolded, antibodies may recognize linear epitopes. Validation against native pig uricase is still recommended.

4. Protein Expression and Purification Protocol Optimization

This application is appropriate. The recombinant uricase can serve as a model for optimizing expression and purification conditions for uricase proteins. The high-purity baseline provides a good starting point for method development.

Final Recommendation & Action Plan

Given the relatively high likelihood of proper folding for this soluble enzyme in E. coli, recommend first conducting functional validation through a uricase activity assay using uric acid as substrate. Simultaneously, perform biophysical characterization (size-exclusion chromatography with multi-angle light scattering) to confirm proper tetramer formation. If activity and quaternary structure are validated, the protein becomes suitable for all described applications. If not, focus on antibody development and biochemical characterization studies. For interaction studies, always include appropriate controls to distinguish specific from non-specific binding.

 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Does any of the components contain the following three? If yes, provide concentration.
1. Sodium azide
2. Thimerosal
3. 2-mercaptoethanol
If it is lyophilized, provide the concentration after the lyophilization.

A:

For CSB-EP025648PI, we do not use the following components during our manufacturing process.
1. Sodium azide
2. Thimerosal
3. 2-mercaptoethanol
It concentration before freeze-drying is 1mg/ml, and customers can reconstitute it with sterile water to the required concentration.

Target Background

Function
Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin.
Subcellular Location
Peroxisome.
Protein Families
Uricase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*