Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial

In Stock
Code CSB-EP343481EWPf0
Abbreviation Recombinant Plasmodium falciparum MSP2 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
MSP2
Uniprot No.
Research Area
Others
Alternative Names
45 kDa merozoite surface antigen;Merozoite surface antigen 2
Species
Plasmodium falciparum (isolate 3D7)
Source
E.coli
Expression Region
109-246aa
Target Protein Sequence
NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.2 kDa
Protein Length
Partial
Tag Info
C-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the merozoite attachment to the erythrocyte.
Gene References into Functions
  1. Genetic polymorphism of Merozoite Surface Protein-2 (MSP-2) in Plasmodium falciparum isolates from Pawe District, North West Ethiopia PMID: 28542247
  2. msp2 genetic profiles iof solates collected from successive malaria episodes in ten children who had four or more clinical episodes during follow up PMID: 23217196
  3. MSP2 Antigenic differences characterized via epitope mapping; results show that there are significant conformational differences between the two forms of MSP2 PMID: 22966050
  4. Allele typing of the msp2 gene detected 55% and 45% of 3D7 and FC27 allelic families in Plasmodium falciparum field isolates from Congolese children with asymptomatic infections. PMID: 22463364
  5. The majority of patients from all the five sites had mean monoclonal infections of 67.1 and 60.4% of P. falciparum for msp-1 and msp-2, respectively, whereas, mean multiple genotypes of 32.8 and 39.5% for msp-1 and msp-2, respectively. PMID: 22325817
  6. the helical structure of the N-terminal region of Plasmodium falciparum merozoite surface protein 2 has a role in fibril formation and membrane interaction PMID: 22304430
  7. Field isolates are highly diverse in respect of MSP2 and multiplicity of infection was neither age nor parasite density dependent in the study population. PMID: 21809706
  8. We tested the hypothesis that sequence diversity in MSP2 renders parasites bearing heterologous MSP2 alleles differentially susceptible to Fc-dependent functions of allele-specific MSP2 antibodies PMID: 21189324
  9. roles of individual residues in fibril formation and local ordered structure in two peptides, a recombinant 25-residue peptide corresponding to the entire N-terminal domain of mature MSP2 and an 8-residue peptide from the central region of this domain PMID: 20542076
  10. Extensive genetic polymorphism with diverse allele types was identified in MSP-1 and MSP-2 in P. falciparum field isolates from Myanmar. PMID: 20478015
  11. reports the functional properties of polyclonal and monoclonal antibodies induced by site-directed designed MSP-2 N-terminus pseudopeptides and their capacity for antibody isotype switching in in vitro immunization PMID: 17881088
  12. The two major complications seen in the subjects, cerebral malaria and severe anaemia, were each found to be significantly associated with the 3D7 subtype of msp-2 PMID: 18577328
  13. analysis of selective pressures on the merozoite surface protein 2 locus of Plasmodium falciparum PMID: 18840512
  14. current and comprehensive information on the diversity in the gene that encodes the merozoite surface protein (MSP) 1 and 2 and its implications on the epidemiology of malaria, immunity and development of control measures [review] PMID: 19326702
  15. MSP2 oligomers containing intermolecular beta-strand interactions similar to those in amyloid fibrils. PMID: 19450733

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Database Links

KEGG: pfa:PFB0300c

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*