Home
Protein
Recombinant Proteins
Recombinant Porcine reproductive and respiratory syndrome virus Nucleocapsid protein (ORF7)

Recombinant Porcine reproductive and respiratory syndrome virus Nucleocapsid protein (ORF7)

^{In Stock}

Code	CSB-EP2163
Abbreviation	Recombinant Porcine reproductive and respiratory syndrome virus ORF7 protein
MSDS	MSDS Datasheet
Size	US$472
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ORF7

Uniprot No.

V5N6H2

Research Area

others

Source

E.coli

Expression Region

1-123aa

Target Protein Sequence

MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.6 kDa

Protein Length

Full Length

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombination of a plasmid encoding the Porcine reproductive and respiratory syndrome virus (PRRSV) ORF7 protein (1-123aa) is the first step during the production the recombinant Porcine reproductive and respiratory syndrome virus (PRRSV) ORF7 protein. The constructed plasmid is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected to be cultured for the induction of protein expression. After expression, affinity purification is used to isolate and purify the recombinant Porcine reproductive and respiratory syndrome virus (PRRSV) ORF7 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Porcine reproductive and respiratory syndrome virus (PRRSV) ORF7 protein. Its purity exceeds 85%.