Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial

In Stock
Code CSB-EP310587EYA
Abbreviation Recombinant Porphyromonas gingivalis rgpB protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP310587EYA could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC BAA-308 / W83) rgpB.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP310587EYA could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC BAA-308 / W83) rgpB.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
rgpB
Uniprot No.
Research Area
Others
Alternative Names
rgpB; prtRII; rgp2; PG_0506Gingipain R2; EC 3.4.22.37; Arg-gingipain; Gingipain 2; RGP-2
Species
Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Source
E.coli
Expression Region
230-473aa
Target Protein Sequence
YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Gingipain R2 (RgpB) is a cysteine proteinase found in Porphyromonas gingivalis, a bacterium associated with periodontal disease. RgpB is one of the three types of gingipains produced by P. gingivalis, with the other two being lysine-specific gingipain (Kgp) and arginine-specific gingipain A (RgpA) [1]. RgpB is characterized by its specificity for cleaving proteins after arginine residues [2]. It is a 50 kDa proteinase that lacks the hemagglutinin/adhesin domains found in other gingipains [3]. The purification of RgpB follows similar methods used for other gingipains like HRgpA and Kgp [4].

RgpB, along with RgpA, works synergistically to release bradykinin directly from high molecular weight kininogen, mimicking the action of kallikrein [5]. Additionally, RgpB has been shown to induce neuropeptide release from dental pulp cells via PAR-2 signaling [6]. The gingipain family, which includes RgpB, plays a crucial role in the pathogenesis of periodontal disease [5]. Furthermore, RgpB has been studied for its role in activating blood coagulation factor IX [7].

References:
[1] N. Li and C. Collyer, "Gingipains fromporphyromonas gingivalis— complex domain structures confer diverse functions", European Journal of Microbiology and Immunology, vol. 1, no. 1, p. 41-58, 2011. https://doi.org/10.1556/eujmi.1.2011.1.7
[2] F. Gibson and C. Genco, "Prevention ofporphyromonas gingivalis-induced oral bone loss following immunization with gingipain r1", Infection and Immunity, vol. 69, no. 12, p. 7959-7963, 2001. https://doi.org/10.1128/iai.69.12.7959-7963.2001
[3] N. Ally, J. Whisstock, M. Sieprawska-Lupa, J. Potempa, B. Bonniec, J. Traviset al., "Characterization of the specificity of arginine-specific gingipains from porphyromonas gingivalis reveals active site differences between different forms of the enzymes", Biochemistry, vol. 42, no. 40, p. 11693-11700, 2003. https://doi.org/10.1021/bi0349726
[4] J. Potempa, J. Mikolajczyk-Pawlinska, D. Brassell, D. Nelson, I. Thøgersen, J. Enghildet al., "Comparative properties of two cysteine proteinases (gingipains r), the products of two related but individual genes ofporphyromonas gingivalis", Journal of Biological Chemistry, vol. 273, no. 34, p. 21648-21657, 1998. https://doi.org/10.1074/jbc.273.34.21648
[5] T. Imamura, "The role of gingipains in the pathogenesis of periodontal disease", Journal of Periodontology, vol. 74, no. 1, p. 111-118, 2003. https://doi.org/10.1902/jop.2003.74.1.111
[6] A. Uehara, M. Naito, T. Imamura, J. Potempa, J. Travis, K. Nakayamaet al., "Dual regulation of interleukin-8 production in human oral epithelial cells upon stimulation with gingipains from porphyromonas gingivalis", Journal of Medical Microbiology, vol. 57, no. 4, p. 500-507, 2008. https://doi.org/10.1099/jmm.0.47679-0
[7] T. Imamura, S. Tanase, T. Hamamoto, J. Potempa, & J. Travis, "Activation of blood coagulation factor ix by gingipains r, arginine-specific cysteine proteinases from porphyromonas gingivalis", Biochemical Journal, vol. 353, no. 2, p. 325, 2001. https://doi.org/10.1042/0264-6021:3530325

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you please kindly advise the delivery time of CSB-EP310587EYA protein? And does this protein guarantee activity?

A:
Thanks for your inquiry. Code: CSB-EP310587EYA
Name: Recombinant Porphyromonas gingivalis Gingipain R2(rgpB),partial
Expression Region: 230-473aa; Partial
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC


1) we have successfully shipped this protein for many times, but there is no inventory at present, so it needs to be prepared again).
2) as for the activity, we have not detected it at present. There is no guarantee that the protein is 100% active.

Target Background

Function
Thiol protease. Acts synergistically with RgpA to catalyze the maturation of fimbrial subunits, such as FimA. Its proteolytic activity is a major factor in both periodontal tissue destruction and in evasion of host defense mechanisms.
Subcellular Location
Secreted.
Protein Families
Peptidase C25 family
Database Links

KEGG: pgi:PG_0506

STRING: 242619.PG0506

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*