Home
Protein
Recombinant Protein
Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial

Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial

^{In Stock}

Code	CSB-EP310587EYA
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP310587EYA could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC BAA-308 / W83) rgpB. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP310587EYA could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC BAA-308 / W83) rgpB.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

rgpB

Uniprot No.

P95493

Research Area

Others

Alternative Names

rgpB; prtRII; rgp2; PG_0506Gingipain R2; EC 3.4.22.37; Arg-gingipain; Gingipain 2; RGP-2

Species

Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

Source

E.coli

Expression Region

230-473aa

Target Protein Sequence

YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

43.3kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Porphyromonas gingivalis Gingipain R2/rgpB (CSB-EP310587EYA) with an N-terminal 6xHis-SUMO-tag is a partial-length recombinant protein generated in E.coli. The expressed region encodes the AA Tyr230-Cys473 of Porphyromonas gingivalis. This recombinant rgpB protein was evaluated by the LC-MS/MS analysis. The purity of this protein is up to 90% through SDS-PAGE analysis. This protein may be used to produce specific antibodies or in the studies of microbiology.

Arginine-specific gingipain 2 (rgpB) is an arginine-specific extra-cellular protease expressed on the surface of the oral pathogen Porphyromonas gingivalis outer membrane. It is one of the major viral virulence factors. Endogenous peptidylarginine deiminase enzyme (P.PAD), a virulence factor capable of citrullinating human and bacterial proteins, including auto-citrullination, interacts with rgpB. RgpB is essential for P. gingivalis to citrullinate peptides. Only after degradation by rgpB can P.PAD convert peptidylarginine into peptidylcitrulline.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Could you please kindly advise the delivery time of CSB-EP310587EYA protein? And does this protein guarantee activity?

Thanks for your inquiry. Code: CSB-EP310587EYA
Name: Recombinant Porphyromonas gingivalis Gingipain R2(rgpB),partial
Expression Region: 230-473aa; Partial
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

1) we have successfully shipped this protein for many times, but there is no inventory at present, so it needs to be prepared again).
2) as for the activity, we have not detected it at present. There is no guarantee that the protein is 100% active.

Target Background

Function

Thiol protease. Acts synergistically with RgpA to catalyze the maturation of fimbrial subunits, such as FimA. Its proteolytic activity is a major factor in both periodontal tissue destruction and in evasion of host defense mechanisms.

Subcellular Location

Secreted.

Protein Families

Peptidase C25 family

Database Links

KEGG: pgi:PG_0506

STRING: 242619.PG0506

Promotions