Recombinant Pseudomonas aeruginosa Beta-lactamase (ampC)

In Stock
Code CSB-EP326492EZX
Abbreviation Recombinant Pseudomonas aeruginosa ampC protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP326492EZX could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) ampC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP326492EZX could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) ampC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ampC
Uniprot No.
Research Area
Others
Alternative Names
ampC; PA4110Beta-lactamase; EC 3.5.2.6; Cephalosporinase
Species
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Source
E.coli
Expression Region
27-397aa
Target Protein Sequence
GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The protein AmpC is a β-lactamase enzyme that confers resistance to β-lactam antibiotics in various bacteria, including Klebsiella pneumoniae, Escherichia coli, and Pseudomonas aeruginosa [1]. AmpC is regulated by several proteins, including AmpR, a transcriptional regulator, and AmpG, a transmembrane permease that functions as a specific permease for 1,6-anhydromurapeptides, which are thought to be the signal molecules involved in ampC induction [2][3][4][5]. Additionally, AmpC has been suggested to function as a putative D,D-endopeptidase, and its overproduction is associated with β-lactam resistance [6]. The regulation of AmpC production requires three proteins: AmpG, AmpD, a cytosolic peptidoglycan-recycling amidase, and AmpR [7]. Furthermore, AmpC has a weak polybasic property and carries numerous positive charges due to the protonation of the amino groups in its backbone [8]. Penicillin-binding proteins (PBPs) also play a role in ampC regulation [9]. AmpR is a positive transcriptional regulator belonging to the LysR family of regulatory proteins [10]. The structural gene for AmpC, ampC, is located close to other genes on the chromosome, such as frdA, the structural gene for the larger subunit of fumarate reductase [11].

References:
[1] Y. Li, G. Li, L. Duo, W. Wang, C. Wang, H. Zhanget al., "Dha-1 plasmid-mediated ampc β-lactamase expression and regulation of klebsiella pnuemoniae isolates", Molecular Medicine Reports, vol. 11, no. 4, p. 3069-3077, 2014. https://doi.org/10.3892/mmr.2014.3054
[2] Y. Tsutsumi, H. Tomita, & K. Tanimoto, "Identification of novel genes responsible for overexpression of ampc in pseudomonas aeruginosa pao1", Antimicrobial Agents and Chemotherapy, vol. 57, no. 12, p. 5987-5993, 2013. https://doi.org/10.1128/aac.01291-13
[3] C. Juan, M. Macià, O. Gutiérrez, C. Vidal, J. Pérez, & A. Oliver, "Molecular mechanisms of β-lactam resistance mediated by ampc hyperproduction inpseudomonas aeruginosaclinical strains", Antimicrobial Agents and Chemotherapy, vol. 49, no. 11, p. 4733-4738, 2005. https://doi.org/10.1128/aac.49.11.4733-4738.2005
[4] C. Juan, B. Moyá, & J. Pérez, "Stepwise upregulation of thepseudomonas aeruginosachromosomal cephalosporinase conferring high-level β-lactam resistance involves three ampd homologues", Antimicrobial Agents and Chemotherapy, vol. 50, no. 5, p. 1780-1787, 2006. https://doi.org/10.1128/aac.50.5.1780-1787.2006
[5] T. Langaee, L. Gagnon, & A. Huletsky, "Inactivation of the ampd gene in pseudomonas aeruginosa leads to moderate-basal-level and hyperinducible ampc β-lactamase expression", Antimicrobial Agents and Chemotherapy, vol. 44, no. 3, p. 583-589, 2000. https://doi.org/10.1128/aac.44.3.583-589.2000
[6] R. Bishop and J. Weiner, "Coordinate regulation of murein peptidase activity and ampc β‐lactamase synthesis in escherichia coli", Febs Letters, vol. 304, no. 2-3, p. 103-108, 1992. https://doi.org/10.1016/0014-5793(92)80598-b
[7] A. Schmidtke and N. Hanson, "Role ofampdhomologs in overproduction of ampc in clinical isolates ofpseudomonas aeruginosa", Antimicrobial Agents and Chemotherapy, vol. 52, no. 11, p. 3922-3927, 2008. https://doi.org/10.1128/aac.00341-08
[8] H. Yao, R. Xiao, T. Yin, K. Shi, H. Yao, & H. Liu, "Switchable bioelectrocatalysis of glucose oxidase immobilized into multilayers with lamellar nanoparticles of amino-functionalized magnesium phyllosilicate clay", Journal of the Electrochemical Society, vol. 168, no. 4, p. 046509, 2021. https://doi.org/10.1149/1945-7111/abf442
[9] C. Liu, C. Li, Y. Chen, H. Hao, J. Liang, R. Duanet al., "Role of low-molecular-mass penicillin-binding proteins, nagz and ampr in ampc β-lactamase regulation of yersinia enterocolitica", Frontiers in Cellular and Infection Microbiology, vol. 7, 2017. https://doi.org/10.3389/fcimb.2017.00425
[10] S. Bratu, D. Landman, J. Gupta, & J. Quale, "Role of ampd, oprf and penicillin-binding proteins in β-lactam resistance in clinical isolates of pseudomonas aeruginosa", Journal of Medical Microbiology, vol. 56, no. 6, p. 809-814, 2007. https://doi.org/10.1099/jmm.0.47019-0
[11] T. Grundström and B. Jaurin, "Overlap between ampc and frd operons on the escherichia coli chromosome.", Proceedings of the National Academy of Sciences, vol. 79, no. 4, p. 1111-1115, 1982. https://doi.org/10.1073/pnas.79.4.1111

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Would you happen to know the activity of this beta lactamase against nitrocefin?

A:
Thanks for your inquiry. I'm afraid we haven't detect the activity of this beta lactamase against nitrocefin. Pls refer to: https://www.ncbi.nlm.nih.gov/pubmed/26142222

Target Background

Gene References into Functions
  1. Among several acquired beta-lactamase enzymes, the blaPER-1 and blaVEB-1, although produced less frequently, have clinical importance because of conferring resistance to oxyimino beta-lactams. PMID: 26944896
  2. Changes have been identified within AmpD responsible for derepression of ampC and conferring ceftazidime resistance. PMID: 27067331
  3. Pseudomonas aeruginosa is able to adapt to efficacious beta-lactams, including the newer cephalosporin ceftolozane, through a variety of mutations affecting its intrinsic beta-lactamase, AmpC. PMID: 26248364
  4. Overexpression of the ampC gene was observed in carbapenem-resistant P. aeruginosa isolates, but no carbapenem-susceptible isolates overexpressed the ampC gene. PMID: 22633564
Subcellular Location
Periplasm.
Protein Families
Class-C beta-lactamase family
Database Links

KEGG: pae:PA4110

STRING: 208964.PA4110

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*