Recombinant Pseudomonas aeruginosa Exotoxin A regulatory protein (toxR)

In Stock
Code CSB-EP357792FQE
Abbreviation Recombinant Pseudomonas aeruginosa toxR protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
toxR
Uniprot No.
Research Area
Others
Alternative Names
toxR; regA; PA0707; Exotoxin A regulatory protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Source
E.coli
Expression Region
1-259aa
Target Protein Sequence
MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFSSPAC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of the recombinant Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) toxR protein involves the construction of a plasmid encoding the Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) toxR protein (1-259aa). This resulting plasmid is introduced into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. The protein is fused with a N-terminal 6xHis-KSI tag. After that, cultured cells are lysed. The subsequent step includes purifying the recombinant Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) toxR protein through affinity purification from the cell lysate and assessing the purity of the protein via SDS-PAGE. The purity of the recombinant toxR protein is greater than 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Positive regulation of toxA gene transcription.
Subcellular Location
Cell inner membrane; Peripheral membrane protein.
Database Links

KEGG: pae:PA0707

STRING: 208964.PA0707

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*