Recombinant Pseudomonas phage phi6 RNA-directed RNA polymerase (P2), partial

In Stock
Code CSB-EP319967PUV
Abbreviation Recombinant Pseudomonas phage phi6 RNA-directed RNA polymerase protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
P2
Uniprot No.
Research Area
Transcription
Alternative Names
Protein P2
Species
Pseudomonas phage phi6 (Bacteriophage phi-6)
Source
E.coli
Expression Region
310-485aa
Target Protein Sequence
NKEEKVKEWSLCVATDVSDHDTFWPGWLRDLICDELLNMGYAPWWVKLFETSLKLPVYVGAPAPEQGHTLLGDPSNPDLEVGLSSGQGATDLMGTLLMSITYLVMQLDHTAPHLNSRIKDMPSACRFLDSYWQGHEEIRQISKSDDAILGWTKGRALVGGHRLFEMLKEGKVNPSP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

RNA-dependent RNA polymerase (RdRp), also known as Protein P2, is an essential enzyme involved in the replication and transcription of RNA in various organisms, including bacteriophages. RdRp catalyzes the synthesis of RNA from an RNA template, playing a central role in viral RNA metabolism [1]. It is responsible for the synthesis of both minus and plus-strand transcripts [2]. The RdRp P2 protein contains the RNA polymerase active site and is required for the replicase and transcriptase activities [3]. Additionally, it has been demonstrated to catalyze single-stranded RNA replication in vitro [1]. The P2 protein has been identified inside the unexpanded procapsid shell, indicating its involvement in minus RNA strand synthesis [4]. Furthermore, the P2 protein is part of the RNA polymerase complex and is involved in the regulation of viral RNA metabolism [1]. The P2 protein also utilizes its acidic C-terminal tail to regulate the RNA-directed RNA polymerase P2, highlighting its multifaceted role in RNA synthesis [3].

References:
[1] E. Makeyev and D. Bamford, "The polymerase subunit of a dsrna virus plays a central role in the regulation of viral rna metabolism", The Embo Journal, vol. 19, no. 22, p. 6275-6284, 2000. https://doi.org/10.1093/emboj/19.22.6275
[2] D. Nemecek, J. Heymann, J. Qiao, L. Mindich, & A. Steven, "Cryo-electron tomography of bacteriophage φ6 procapsids shows random occupancy of the binding sites for rna polymerase and packaging ntpase", Journal of Structural Biology, vol. 171, no. 3, p. 389-396, 2010. https://doi.org/10.1016/j.jsb.2010.06.005
[3] S. Alphonse, J. Arnold, S. Bhattacharya, H. Wang, B. Kloss, C. Cameronet al., "Cystoviral polymerase complex protein p7 uses its acidic c-terminal tail to regulate the rna-directed rna polymerase p2", Journal of Molecular Biology, vol. 426, no. 14, p. 2580-2593, 2014. https://doi.org/10.1016/j.jmb.2014.04.028
[4] J. Heymann, D. Nemecek, N. Cheng, J. Qiao, L. Mindich, & A. Steven, "Expansion of the bacteriophage φ6 procapsid revealed by electron cryo-microscopy", Microscopy and Microanalysis, vol. 15, no. S2, p. 586-587, 2009. https://doi.org/10.1017/s1431927609098390

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am looking for an RNA dependent RNA polymerase to create dsRNA starting from a ssRNA template. Is the protein (Recombinant Pseudomonas phage phi6 RNA-directed RNA polymerase (P2), partial) that is sold on by your company functional? Or is it only to be used in western blots?

A:

Currently, it's only used in Western blots. We haven't tested the activity of this protein in our lab. We can't guarantee it will be active. This protein's expression region is 310-485aa, it's not a full-length protein. That's why we add “partial” after the name of the protein.

Target Background

Function
Rna-dependent RNA polymerase part of the packaging complex that packages the viral RNA segments, replicate them into a double-stranded form and transcribe them.
Gene References into Functions
  1. Purified polymerase P2 is able to transcribe dsRNA, but transcription behavior of bacteriophage Phi6 RNA segment L by both wild-type and mutant polymerases is different from that seen in capsid structures. PMID: 23864621
  2. The structurally flexible hinge region appeared to be involved in the control of priming platform movement. PMID: 22770923
  3. Divalent cations modulate the structural dynamics of phi6 RNA-dependent RNA polymerase. PMID: 22205747
Subcellular Location
Virion. Note=Found in the capsid (12 copies). Prior to RNA packaging, localizes on the inner procapsid surface near the three-fold axis of symmetry.
Database Links

KEGG: vg:956436

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*