Home
Protein
Recombinant Proteins
Recombinant Puccinia triticina Uncharacterized protein (PTTG_11654)

Recombinant Puccinia triticina Uncharacterized protein (PTTG_11654)

^{In Stock}

Code	CSB-EP3751GPC
Abbreviation	Recombinant Puccinia triticina PTTG_11654 protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PTTG_11654

Uniprot No.

A0A180GYK0

Research Area

Others

Species

Puccinia triticina (isolate 1-1 / race 1 (BBBD)) (Brown leaf rust fungus)

Source

E.coli

Expression Region

19-177aa

Target Protein Sequence

DSAQSNASMSASQPKVSPMQCGNIFLPLSPVDIAEMQSKGGLSASERAKLSKDPVEAVCKSTATGTDGGICDFKSCSGKPAVCGTCYPVTMKEGKLVKTSETSVASVECGKNYFLKTEKDHNICTAYDNKMYSCTGECKASIECQSCVRMDDPAFKQAA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The process of expressing the recombinant Puccinia triticina (isolate 1-1 / race 1 (BBBD)) PTTG_11654 protein includes transfecting e.coli cells with a DNA expression vector carrying the gene for the desired protein (19-177aa). Subsequently, the cells are cultured to induce the expression of the intended protein. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. The recombinant Puccinia triticina (isolate 1-1 / race 1 (BBBD)) PTTG_11654 protein is then collected and purified from the cell lysate through affinity purification, exhibiting a purity exceeding 90%, as verified by SDS-PAGE.