Recombinant Rabies virus Matrix protein(M)

Code CSB-YP322192RAI
Product Type Recombinant Protein
Size US$2959
Uniprot No. P15200
Relevance Plays a major role in assbly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Phosphoprotein M2
Species Rabies virus (strain PM1503/AVO1) (RABV)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE
Research Area Others
Source Yeast
Gene Names M
Protein Names Recommended name: Matrix protein Alternative name(s): Phosphoprotein M2
Expression Region 1-202aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 25.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity).
Subcellular Location Virion membrane, Peripheral membrane protein, Host endomembrane system, Peripheral membrane protein
Protein Families Lyssavirus matrix protein family

Related Products

M Antibodies

M Antibodies for Rabies virus (strain PM1503/AVO1) (RABV)

M Antibodies for Rabies virus

M Proteins

M Proteins for Rabies virus (strain PM1503/AVO1) (RABV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.