Recombinant Rat Protein S100-A9 (S100a9)

In Stock
Code CSB-EP020642RA
Abbreviation Recombinant Rat S100a9 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020642RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a9.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020642RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a9.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
S100a9; Mrp14Protein S100-A9; Calgranulin-B; Migration inhibitory factor-related protein 14; MRP-14; p14; Myeloid-related protein 14; S100 calcium-binding protein A9
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
2-113aa
Target Protein Sequence
AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 2-113 constitute the expression domain of recombinant Rat S100a9. The calculated molecular weight for this S100a9 protein is 29 kDa. This S100a9 protein is produced using e.coli expression system. The S100a9 coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant S100a9 protein in following stages of expression and purification.

The rat protein S100-A9 (S100a9) is a member of the S100 family of calcium-binding proteins. S100a9 often forms a heterodimer with S100a8, and together they constitute the S100A8/A9 complex, also known as calprotectin. This complex plays a role in inflammatory responses and is predominantly expressed in myeloid cells. S100a9 has been associated with various immune-related functions, including the regulation of inflammatory processes, antimicrobial activity, and the modulation of cell migration. Research areas related to S100a9 encompass studies on inflammation, autoimmune diseases, and infectious diseases. Understanding the role of S100a9 in these contexts can provide insights into its contributions to immune responses and potential implications for therapeutic interventions targeting inflammatory conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif.
Gene References into Functions
  1. these results suggest that calprotectin, along with other inflammatory factors, promotes the inflammation seen in mild food allergy PMID: 28454097
  2. Recombinant rat r-S100A9 bound to r-CD68. The expression levels of S100A9 were significantly suppressed after the macrophages had been treated with an anti-CD68 antibody. Small interfering CD68 also significantly suppressed activation of macrophages through an autocrine pathway by r-S100A9. PMID: 27312849
  3. In dextran sulfate sodium-induced colitis fecal levels of S100A9 detected by ELISA were significantly elevated before microscopic damage was detected. PMID: 27693389
  4. Decreased S100A9 expression promoted airway smooth muscle cell proliferation by stimulating reactive oxygen species generation and inhibiting p38 MAPK. PMID: 28050155
  5. Expression of S100A9 mRNA and the corresponding protein in cultured NRVCs was similar between control cells and NE-stimulated cells, but was markedly upregulated at 12 hours after the withdrawal of NE PMID: 25820336
  6. in ulcerative colitis rats the immune functions of macrophages are regulated in a complex manner by r-S100A8 and/or r-S100A9 through undefined autocrine pathways on the cells PMID: 25485702
  7. S100a9 is a memory-related gene, which is affected by the presence of occlusal support in rats. PMID: 24370184
  8. Data indicate that serum calprotectin levels correlated with serum levels of TNF-alpha and IL6 in TNBS colitis. PMID: 23685388
  9. results suggest that the increased serum S100A8/A9 concentrations following acute myocardial infarction were not of cardiac myocyte origin PMID: 21887593
  10. To understand the possible role of S100A9 in asthma, the effects of the S100A9 were investigated in a rat model of asthma and in isolated tracheal spirals. PMID: 20599758
  11. Phosphorylation inhibits tubulin polymerization in microtubules. PMID: 15331440
  12. An interaction between a subpopulation of neutrophils and the central nervous system during peripheral tissue inflammation is implied by the apparent release and possible diffusion of S100A8 and S100A9 through the endothelial blood-brain barrier. PMID: 18063312

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein.
Protein Families
S-100 family
Tissue Specificity
Highly expressed at sites of inflammation.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*