Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
S100a9; Mrp14Protein S100-A9; Calgranulin-B; Migration inhibitory factor-related protein 14; MRP-14; p14; Myeloid-related protein 14; S100 calcium-binding protein A9
Species
Rattus norvegicus (Rat)
Expression Region
2-113aa
Target Protein Sequence
AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 2-113 constitute the expression domain of recombinant Rat S100a9. The calculated molecular weight for this S100a9 protein is 29 kDa. This S100a9 protein is produced using e.coli expression system. The S100a9 coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant S100a9 protein in following stages of expression and purification.
The rat protein S100-A9 (S100a9) is a member of the S100 family of calcium-binding proteins. S100a9 often forms a heterodimer with S100a8, and together they constitute the S100A8/A9 complex, also known as calprotectin. This complex plays a role in inflammatory responses and is predominantly expressed in myeloid cells. S100a9 has been associated with various immune-related functions, including the regulation of inflammatory processes, antimicrobial activity, and the modulation of cell migration. Research areas related to S100a9 encompass studies on inflammation, autoimmune diseases, and infectious diseases. Understanding the role of S100a9 in these contexts can provide insights into its contributions to immune responses and potential implications for therapeutic interventions targeting inflammatory conditions.
