Recombinant Rat Trypsin-4 (Try4)

In Stock
Code CSB-EP319450RA
Abbreviation Recombinant Rat Try4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Try4
Uniprot No.
Research Area
Cell Biology
Alternative Names
Try4; Trypsin-4; EC 3.4.21.4; Pretrypsinogen IV; Trypsin IV
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
24-247aa
Target Protein Sequence
IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Trypsin-4 (Try4) is produced in E. coli and contains the full length of the mature protein, covering amino acids 24 to 247. With an N-terminal 6xHis-tag, this protein is purified to over 85% as determined by SDS-PAGE analysis. It's designed strictly for research use, offering what appears to be a dependable tool for various biochemical applications.

Trypsin-4 is a serine protease that plays a role in protein digestion. Part of the trypsin family, it seems to be critical for catalyzing the hydrolysis of peptide bonds, which breaks down proteins. Scientists frequently study this enzyme for its role in protein processing, and it's become essential in research examining proteolytic pathways and digestive enzyme function.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-tagged recombinant rat trypsin-4 can be attached to nickel-affinity resins to find potential binding partners or substrates in rat tissue lysates or cell extracts. This method may allow researchers to explore the molecular interactions of Try4 across different biological settings. The high purity (>85%) likely reduces background binding from contaminating proteins during pull-down experiments. These studies could reveal insights into cellular pathways and regulatory networks that involve rat trypsin-4.

2. Antibody Development and Validation

This recombinant protein works well as an antigen for creating specific antibodies against rat trypsin-4, both polyclonal and monoclonal types. Since the full-length mature protein (24-247aa) includes the complete antigenic profile, antibodies should recognize native rat Try4 in different research settings. Scientists can use this protein for antibody screening, specificity testing, and measuring binding strength through ELISA-based assays. The His-tag makes purification and attachment straightforward for antibody validation work.

3. Structural and Biochemical Characterization Studies

Recombinant rat trypsin-4 can be used for detailed structural analysis using methods like X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy. Scientists can examine the three-dimensional structure, folding patterns, and shape changes of this serine protease family member. High purity levels make it suitable for biophysical studies including thermal stability analysis, circular dichroism spectroscopy, and dynamic light scattering experiments. Such work might help explain the molecular basis of Try4 function and its evolutionary development.

4. Comparative Proteomics and Species-Specific Studies

This rat-specific trypsin-4 protein makes possible comparative studies with trypsin relatives from other species to explore evolutionary relationships and functional differences. Researchers can conduct cross-species binding studies, compare substrate preferences, and perform genetic analyses using this well-defined recombinant protein. The E. coli expression system appears to provide consistent protein production for larger comparative experiments. Research like this could advance our understanding of trypsin family evolution and how digestive enzymes have adapted differently across species.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted, extracellular space.
Protein Families
Peptidase S1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*