Recombinant Rat Trypsin-4 (Try4)

^{In Stock}

Code	CSB-YP319450RAa4
Abbreviation	Recombinant Rat Try4 protein
MSDS	MSDS Datasheet
Size	US$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Try4

Uniprot No.

P12788

Research Area

Cell Biology

Alternative Names

Try4; Trypsin-4; EC 3.4.21.4; Pretrypsinogen IV; Trypsin IV

Species

Rattus norvegicus (Rat)

Source

Yeast

Expression Region

24-247aa

Target Protein Sequence

IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-sumostar-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Boost your research in the field of Cell Biology with our Recombinant Rat Try4, also known as Trypsin-4. Synthesized in yeast, this protein mirrors the mature form in its entirety, from the 24th to the 247th amino acid. This precise composition makes it an excellent tool for further understanding various cellular processes.

Equipped with an innovative N-terminal 6xHis-sumostar tag, this version of Try4 facilitates seamless purification and easy detection in your experimental workflow. With a purity of over 85% as established by SDS-PAGE, the quality is ensured. The product comes in two forms - liquid or lyophilized powder, granting flexibility in storage and use. Elevate your scientific exploration with our top-tier Recombinant Rat Try4 today.