Recombinant Rat Trypsin-4(Try4)

In Stock
Code CSB-YP319450RAa4
Product Type Recombinant Protein
Size US$2959
Uniprot No. P12788
Lead Time 3-7 business days
Relevance Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN
Research Area Cell Biology
Source Yeast
Gene Names Try4
Protein Names Pretrypsinogen IV Trypsin IV
Expression Region 24-247aa
Tag Info N-terminal 6xHis-sumostar-tagged
Mol. Weight 40.1 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted, extracellular space
Protein Families Peptidase S1 family
Database Links

KEGG: rno:286960

STRING: 10116.ENSRNOP00000017852

UniGene: Rn.10387

Related Products

Try4 Antibodies

Try4 Antibodies for Rattus norvegicus (Rat)

Try4 Proteins

Try4 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.