Recombinant Rat Alpha-1-acid glycoprotein (Orm1)

In Stock
Code CSB-EP360882RAa0
Abbreviation Recombinant Rat Orm1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Orm1
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Orm1Alpha-1-acid glycoprotein; Orosomucoid; OMD
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
19-205aa
Target Protein Sequence
QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) is expressed in E. coli and includes an N-terminal 6xHis tag that makes purification more straightforward. The protein covers the complete mature sequence from amino acids 19 to 205. SDS-PAGE analysis shows the product is greater than 85% pure, which appears sufficient for most research applications. This protein is intended for research use only and not for diagnostic or therapeutic purposes.

Alpha-1-acid glycoprotein is an acute-phase plasma protein that seems primarily involved in modulating immune responses. It likely plays an important role in inflammatory processes and is known to bind various ligands, which may affect their distribution and availability. As a major serum protein, Orm1 is frequently studied for its contribution to immune modulation and its potential as a biomarker in research settings.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis tag on this recombinant rat Orm1 protein allows for nickel-affinity based pull-down experiments to identify potential binding partners. Researchers can immobilize the protein on nickel-coated beads or columns and incubate it with rat tissue lysates or purified proteins to capture interacting molecules. This approach may be particularly valuable for studying Orm1's role in acute phase response pathways and identifying novel regulatory proteins. While the >85% purity level appears sufficient for these interaction studies, contaminating proteins can typically be distinguished through mass spectrometry analysis of pulled-down complexes.

2. Antibody Development and Validation

This recombinant rat Orm1 protein serves as a useful antigen for generating specific antibodies against rat alpha-1-acid glycoprotein. The purified protein can be used for immunizing animals to produce polyclonal antibodies or screening hybridomas for monoclonal antibody production. The His-tagged protein also functions as a positive control in ELISA-based antibody characterization assays, allowing researchers to determine antibody specificity, affinity, and cross-reactivity. Since the mature protein sequence (19-205aa) represents the native form, it should be suitable for developing antibodies that recognize endogenous rat Orm1.

3. Biochemical Characterization and Ligand Binding Studies

Researchers can use the recombinant protein in biochemical assays to characterize the binding properties of rat Orm1 with various ligands, including drugs, lipids, and other small molecules. Fluorescence polarization, surface plasmon resonance, or isothermal titration calorimetry experiments can determine binding kinetics and thermodynamic parameters. The protein's purity level of >85% is likely adequate for these quantitative binding studies, though appropriate controls should be included to account for any remaining contaminants.

4. Comparative Species Analysis in Acute Phase Response Research

This rat Orm1 protein can be used alongside human and mouse orthologs in comparative studies to understand species-specific differences in acute phase protein function. Scientists can perform side-by-side binding assays, stability studies, or structural comparisons to identify conserved and divergent functional domains. The recombinant protein may enable controlled experiments where species-specific effects can be isolated from other variables, potentially contributing to translational research that bridges rodent models and human physiology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
Gene References into Functions
  1. fatigue upregulates the level of ORM1, which in turn functions as an anti-fatigue protein to enhance muscle endurance via the CCR5 pathway. PMID: 26740279
  2. context-dependent nature of ORM1 angioregulatory function is further demonstrated in the CAM assay where ORM1 stimulates developmental angiogenesis without exerting any inhibitory activity PMID: 22916107
  3. alpha-1 acid glycoprotein expression is increased by retinoids at the transcriptional level through two distinct DR1 retinoic acid responsive elements PMID: 15157739
  4. Surprisingly, AGP-over-expressing mice were not protected against renal ischemia-reperfusion injury. PMID: 15502707
  5. Orm1 gene expression highly induced in cardiomyocytes overexpressing mineralocorticoid receptor and treated with aldosterone. PMID: 17234708

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*