Recombinant Rat Alpha-1-acid glycoprotein (Orm1)

In Stock
Code CSB-EP360882RAa0
Abbreviation Recombinant Rat Orm1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Orm1
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Orm1Alpha-1-acid glycoprotein; Orosomucoid; OMD
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
19-205aa
Target Protein Sequence
QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) is expressed in E. coli and includes an N-terminal 6xHis tag that makes purification more straightforward. The protein covers the complete mature sequence from amino acids 19 to 205. SDS-PAGE analysis shows the product is greater than 85% pure, which appears sufficient for most research applications. This protein is intended for research use only and not for diagnostic or therapeutic purposes.

Alpha-1-acid glycoprotein is an acute-phase plasma protein that seems primarily involved in modulating immune responses. It likely plays an important role in inflammatory processes and is known to bind various ligands, which may affect their distribution and availability. As a major serum protein, Orm1 is frequently studied for its contribution to immune modulation and its potential as a biomarker in research settings.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rat Orm1 is a complex eukaryotic glycoprotein that requires precise folding, proper glycosylation, and specific post-translational modifications for its functional activity in the acute phase response. The E. coli expression system cannot provide the necessary eukaryotic glycosylation and complex folding environment required for this heavily glycosylated protein. While the protein may be soluble, it is highly unlikely to achieve the correct folding and glycosylation pattern needed for functional ligand-binding activity.

1. Antibody Development and Validation

Antibody development against linear epitopes is reliable, but glycosylation-dependent epitopes will not be represented. This recombinant Orm1 serves as an excellent immunogen for generating antibodies against linear epitopes of rat alpha-1-acid glycoprotein. However, antibodies may not efficiently recognize conformational epitopes or glycosylation-dependent epitopes on the native, properly glycosylated protein found in physiological conditions.

2. Biochemical Characterization

Basic biophysical characterization can be performed to assess the protein's physical properties. However, functional characterization studies will be limited due to the lack of glycosylation. Techniques like circular dichroism and size-exclusion chromatography can provide structural insights, but results will reflect a non-glycosylated form.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional version of this heavily glycosylated acute-phase protein. This non-glycosylated recombinant Orm1 is primarily suitable for developing linear epitope antibodies and basic biophysical characterization. Glycoprotein interactions require proper glycosylation and tertiary structure that E. coli cannot provide. Avoid interaction studies and functional studies entirely due to the critical importance of glycosylation for this protein's structure and function. For reliable Orm1 research, use mammalian expression systems that support proper glycosylation, or work with native protein purified from biological sources where correct glycosylation is preserved. Begin with basic biophysical characterization to understand the properties of this specific preparation, then proceed with linear epitope antibody development. For functional studies, alternative expression systems or native protein sources are essential.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
Gene References into Functions
  1. fatigue upregulates the level of ORM1, which in turn functions as an anti-fatigue protein to enhance muscle endurance via the CCR5 pathway. PMID: 26740279
  2. context-dependent nature of ORM1 angioregulatory function is further demonstrated in the CAM assay where ORM1 stimulates developmental angiogenesis without exerting any inhibitory activity PMID: 22916107
  3. alpha-1 acid glycoprotein expression is increased by retinoids at the transcriptional level through two distinct DR1 retinoic acid responsive elements PMID: 15157739
  4. Surprisingly, AGP-over-expressing mice were not protected against renal ischemia-reperfusion injury. PMID: 15502707
  5. Orm1 gene expression highly induced in cardiomyocytes overexpressing mineralocorticoid receptor and treated with aldosterone. PMID: 17234708

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*