Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Cryaa

Uniprot No.

P24623

Research Area

Neuroscience

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

1-196aa

Target Protein Sequence

MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.4 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Contributes to the transparency and refractive index of the lens. Acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions. Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA.; Inhibits bacterial growth in the lens.

Gene References into Functions

Rat crystallin alpha A a encode activated chaperones. PMID: 26378715
Cryaa is a moonlighting protein that functions as a heat shock protein as well as a lens crystalline. PMID: 7556464
The alphaA- and alphaB-crystallin peptides inhibited stress-induced aggregation of four client proteins, and the alphaA-acetyl peptide was more effective than the native peptide against three of the client proteins. PMID: 23508955
alphaA-crystallin and alphaB-crystallin reside in separate subcellular compartments in the developing ocular lens PMID: 23071119
The main differences, which could be attributed to the cataract-specific processes, are the faster decay of the content of gamma-crystallins and the significant decrease of unmodified alphaA-crystallin abundance in the senescent rat lenses. PMID: 21677790
Curcumin suppressed the expression of selenite-induced alphaA- and alphaB-crystallin and Hsp 70, and may therefore suppress cataract formation in rat pups PMID: 21311744
hydroxylation and subsequent phosphorylation of a proline residue in alpha-crystallin A in the eye as well as in heart tissue of rat. PMID: 20682783
An important role is demonstrated for the C-terminal extension of alpha A crystallin, Arg-163 in particular, whereas no significant role is found for the C-terminal flexible tail in the oligomer assembly of alpha A-crystallin. PMID: 14529298
In samples from rats of all ages, the content of alpha A crystallin is significantly decreased in the oldest rats, indicative that protection against stress-induced protein aggregation is compromised in the aged retina. PMID: 14690441
The results indicate that elevated expression of alpha-crystallins in some tissues may have implications in pathophysiology of diabetic complications. PMID: 16309625
The role of arginine-163 is to provide a positive charge for intersubunit electrostatic interactions in the carboxy-terminal domain of alpha A-crystallin. PMID: 17176090
alpha A-K11T and alpha B-K90T/K92T mutants showed the largest decrease in glycation and increase in chaperone activity. PMID: 18158587
Enhanced survival of axotomized axons was observed beyond the crush site after a single intravitreal administration of alpha-crystallin at the time of axotomy. PMID: 18551258

Hide All

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

Small heat shock protein (HSP20) family

Tissue Specificity

Highly expressed in eye lens. Also expressed in non-lenticular tissues such as brain, spleen, liver, lung, skin, small intestine and a several epithelial and fibroblast cell lines with highest levels in spleen.

Database Links

KEGG: rno:24273

STRING: 10116.ENSRNOP00000065714

UniGene: Rn.127769

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP006007RA
Abbreviation	Recombinant Rat Cryaa protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Alpha-crystallin A chain (Cryaa)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage