Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
cell-matrix adhesion
Alternative Names
Brain-enriched hyaluronan-binding protein
Short name:
BEHAB
Species
Rattus norvegicus (Rat)
Expression Region
658-786aa
Target Protein Sequence
DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal hFC-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our Recombinant Rat Brevican core protein is a valuable tool for your cell-matrix adhesion studies. The protein, originating from the 'Bcan' gene of Rat species, is known as a member of the lectican family of chondroitin sulfate proteoglycans, playing an important role in central nervous system development and synaptic plasticity. It has been carefully replicated from mammalian cells, capturing a partial sequence from the 658th to the 786th amino acid of the native protein.
Our Brevican core protein is uniquely designed with a C-terminal hFc-tag, facilitating ease in purification and detection processes. A purity of greater than 85% as validated by SDS-PAGE, underlines the superior quality we strive to maintain. The Recombinant Rat Brevican core protein is conveniently offered in two formats - liquid or lyophilized powder, allowing flexibility in your research design.
