Recombinant Rat Brevican core protein (Bcan), partial

In Stock
Code CSB-BP002590RA
Abbreviation Recombinant Rat Bcan protein, partial
MSDS
Size $528
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Bcan
Uniprot No.
Research Area
cell-matrix adhesion
Alternative Names
Brain-enriched hyaluronan-binding protein Short name: BEHAB
Species
Rattus norvegicus (Rat)
Source
Baculovirus
Expression Region
658-786aa
Target Protein Sequence
DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Rat Bcan protein in baculovirus cells is a multi-step process, including constructing the expression vector coding for the Rat Bcan protein (658-786aa), transforming the recombinant vector into baculovirus cells, selecting the cells that containing the vector and cultivating them, performing cell lysis, collecting the protein, and characterizing the protein. The resulting recombinant Rat Bcan protein is purified from the cell lysate through affinity purification, and its purity, determined by SDS-PAGE, is greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor.
Gene References into Functions
  1. High Brevican expression is associated with glioma tumor aggressiveness. PMID: 25052349
  2. during excitotoxic neurodegeneration the observed ADAMTS-induced cleavage of brevican in the dentate outer molecular layer is closely associated with diminished synaptic density PMID: 12379262
  3. The expression pattern and cell associations of inhibitory brevican have important implications for axon regeneration across acute and chronic spinal cord scar tissue. PMID: 12526031
  4. B/b130 glycovariant of BEHAB/brevican is up-regulated during rat brain development and in a rat model of invasive glioma PMID: 12799382
  5. In a rodent model of neonatal hypoxia-ischemia, a marked decline is found in the expression of brevican, whose expression is correlated with oligodendrocyte survival, growth, and maturation. PMID: 15817274
  6. TGFbeta may play a role in neuronal plasticity through its regulation of brevican and the activity of the ADAMTSs. PMID: 15935069
  7. Brevican is primarily synthesized by co-cultured GFAP-positive astrocytes and co-assembles with its interaction partners in perineuronal net-like structures on neuronal somata & neurites; axon initial segments are strongly covered by a dense brevican coat PMID: 16503162
  8. Brevican deposition is elevated in response to progressive gray matter injury, whereas diminished versican expression may be associated with deep cerebral white matter injury. PMID: 17972319

Show More

Hide All

Subcellular Location
[Isoform 1]: Secreted, extracellular space, extracellular matrix.; [Isoform 2]: Membrane; Lipid-anchor, GPI-anchor.
Protein Families
Aggrecan/versican proteoglycan family
Tissue Specificity
Brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*