Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Bcan

Uniprot No.

P55068

Research Area

cell-matrix adhesion

Alternative Names

Brain-enriched hyaluronan-binding protein Short name: BEHAB

Species

Rattus norvegicus (Rat)

Source

Baculovirus

Expression Region

658-786aa

Target Protein Sequence

DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The production of recombinant Rat Bcan protein in baculovirus cells is a multi-step process, including constructing the expression vector coding for the Rat Bcan protein (658-786aa), transforming the recombinant vector into baculovirus cells, selecting the cells that containing the vector and cultivating them, performing cell lysis, collecting the protein, and characterizing the protein. The resulting recombinant Rat Bcan protein is purified from the cell lysate through affinity purification, and its purity, determined by SDS-PAGE, is greater than 90%.

Target Background

Function

May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Isoform 2 may function as a chondroitin sulfate-bearing cell surface receptor.

Gene References into Functions

High Brevican expression is associated with glioma tumor aggressiveness. PMID: 25052349
during excitotoxic neurodegeneration the observed ADAMTS-induced cleavage of brevican in the dentate outer molecular layer is closely associated with diminished synaptic density PMID: 12379262
The expression pattern and cell associations of inhibitory brevican have important implications for axon regeneration across acute and chronic spinal cord scar tissue. PMID: 12526031
B/b130 glycovariant of BEHAB/brevican is up-regulated during rat brain development and in a rat model of invasive glioma PMID: 12799382
In a rodent model of neonatal hypoxia-ischemia, a marked decline is found in the expression of brevican, whose expression is correlated with oligodendrocyte survival, growth, and maturation. PMID: 15817274
TGFbeta may play a role in neuronal plasticity through its regulation of brevican and the activity of the ADAMTSs. PMID: 15935069
Brevican is primarily synthesized by co-cultured GFAP-positive astrocytes and co-assembles with its interaction partners in perineuronal net-like structures on neuronal somata & neurites; axon initial segments are strongly covered by a dense brevican coat PMID: 16503162
Brevican deposition is elevated in response to progressive gray matter injury, whereas diminished versican expression may be associated with deep cerebral white matter injury. PMID: 17972319

Hide All

Subcellular Location

[Isoform 1]: Secreted, extracellular space, extracellular matrix.; [Isoform 2]: Membrane; Lipid-anchor, GPI-anchor.

Protein Families

Aggrecan/versican proteoglycan family

Tissue Specificity

Brain.

Database Links

KEGG: rno:25393

STRING: 10116.ENSRNOP00000025496

UniGene: Rn.10315

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-BP002590RA
Abbreviation	Recombinant Rat Bcan protein, partial
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Brevican core protein (Bcan), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage