Recombinant Rat Chondroitin sulfate proteoglycan 4 (Cspg4), partial

Code CSB-YP006076RA
Abbreviation Recombinant Rat Cspg4 protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Chondroitin sulfate proteoglycan NG2;HSN tumor-specific antigen
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
575-1044aa
Target Protein Sequence
GPEIFQAYDPDSACEGLTIQLLGVSASVPVEHRDQPGEPVTEFSCRDLEAGNIVYVHRGGPAQDLTFRVSDGMQASGPATLKVVAVRPAIQILHNTGLRLAQGSAAAILPANLSVETNAVGQDVSVLFRVTGTLQFGELQKQGAGGVEGTEWWDTLAFHQRDVEQGRVRYLSTDPQHHTQDTVEDLTLEVQVGQETLSNLSFPVTIQRATVWMLQLEPLHTQNPHQETLTSAHLEASLEEEGEGGPYPHIFHYELVQAPRRGNLLLQGTRLSDGQSFSQSDLQAGRVTYRATTRTSEAAEDSFRFRVTSPPHFSPLYTFPIHIGGDPNAPVLTNVLLMVPEGGEGVLSADHLFVKSLNSASYLYEVMEQPHHGSLAWRDPKGRATPVTSFTNEDLLHGRLVYQHDDSETIEDDIPFVATRQGEGSGDMAWEEVRGVFRVAIQPVNDHAPVQTISRVFHVARGGQRLLTTD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Proteoglycan playing a role in cell proliferation and migration which stimulates endothelial cells motility during microvascular morphogenesis. May also inhibit neurite outgrowth and growth cone collapse during axon regeneration. Cell surface receptor for collagen alpha 2(VI) which may confer cells ability to migrate on that substrate. Binds through its extracellular N-terminus growth factors, extracellular matrix proteases modulating their activity. May regulate MPP16-dependent degradation and invasion of type I collagen participating in melanoma cells invasion properties. May modulate the plasminogen system by enhancing plasminogen activation and inhibiting angiostatin. Functions also as a signal transducing protein by binding through its cytoplasmic C-terminus scaffolding and signaling proteins. May promote retraction fiber formation and cell polarization through Rho GTPase activation. May stimulate alpha-4, beta-1 integrin-mediated adhesion and spreading by recruiting and activating a signaling cascade through CDC42, ACK1 and BCAR1. May activate FAK and ERK1/ERK2 signaling cascades.
Gene References into Functions
  1. chondroitin sulfate proteoglycan 4 (CSPG4) is a potential mesenchymal progenitor cells marker. PMID: 27582000
  2. These findings indicate that Col VI provided a characteristic microenvironment in the GOR and that NG2-Col VI interactions may regulate the differentiation of osteoblast lineages prior to terminal maturation. PMID: 27498042
  3. studies suggest that proteoglycan-mediated entrapment upon NG2+ cells is an additional obstacle to CNS axon regeneration. PMID: 25471575
  4. our data suggested that NG2 proteoglycan expression and secretion hallmarked demarcation as a process that actively separated necrosis from vital tissue and therefore decisively impacts secondary neurodegeneration after ischemic stroke. PMID: 22640018
  5. In a transient 90-min middle cerebral artery occlusion (MCAO) model of rats, a large ischemic lesion is formed where macrophage-like cells massively accumulate, many of which express a macrophage marker, NG2 PMID: 19861972
  6. results indicate that NG2 mediates the induction of iNOS and inflammatory cytokine expression, but not the chemokine expression in activated microglia. PMID: 19878709
  7. NG2+ cells derived from the spinal cord following injury expressed high levels of laminin and fibronectin which promote neurite outgrowth. PMID: 20053907
  8. identified a novel repeat named CSPG in the central ectodomain PMID: 12220645
  9. Multiple protein domains of the NG2 proteoglycan inhibit neurite growth and induce growth cone collapse. PMID: 12514214
  10. The expression patterns and cell associations of inhibitory CSPG4 have important implications for axon regeneration across acute and chronic spinal cord scar tissue. PMID: 12526031
  11. NG2 is expressed by a distinct cell population in the mature central nervous system with the homogeneous antigenic phenotype of oligodendrocyte progenitors. PMID: 14572468
  12. After peripheral nerve injury in rats and humans, an accumulation of NG2-positive cells was observed at the injury site. In the rat, there was an increase in NG2 glycanation for at least 2 weeks following injury. PMID: 14664826
  13. Electroconvulsive seizures dramatically increased the proliferation of amygdala cells expressing the oligodendrocyte progenitor marker NG2. PMID: 15023573
  14. PKC-alpha-mediated NG2 phosphorylation at Thr(2256) is a key step for initiating cell polarization and motility PMID: 15504744
  15. Since NG2 loss in a rodent model of hypoxia-ischemia (H-I) occurs around the time of progressive cell death and appearance of the infarct, it may be that H-I rapidly induces a cellular response that actively depletes Ng2 from the hippocampal matrix. PMID: 15817274
  16. NG2 is expressed by all perivascular cells along arterioles, and its absence denotes a venule-specific phenotype PMID: 15824037
  17. Ectodomain shedding converts NG2 into a diffusible entity able to interact with the growth cone, and we suggest that this release is likely to enhance its axon growth-inhibitory activity PMID: 15866049
  18. These data suggest that NG2+ MG in normal developing or pathologic brains are involved in the genesis or regeneration of the brain. PMID: 16534776
  19. NG2 proteoglycan expression is transiently upregulated along venules during microvascular remodeling PMID: 16627368
  20. These results suggest that NG2 positive cells which derived from subpial layer, may have some lineage to RG after SCI in adult rodents. PMID: 16902766
  21. We propose that during development NG2(+)/A2B5(-) cells (pre-OPCs) represent the direct ancestor to A2B5(+) O2A progenitor cells (OPCs). PMID: 17503442
  22. Differential phosphorylation of NG2 proteoglycan by ERK and Pkca helps balance cell proliferation and cell movement. PMID: 17591920
  23. NG2 participates in the development and progression of glomerulosclerosis by stimulating proliferation of mesangial cells and deposition of extracellular matrix. PMID: 17686464

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein; Extracellular side. Apical cell membrane; Single-pass type I membrane protein; Extracellular side. Cell projection, lamellipodium membrane; Single-pass type I membrane protein; Extracellular side. Cell surface.
Tissue Specificity
Neural cells and also extraneural tissues, especially in the developing mesenchyme.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*